KEGG   Salmo salar (Atlantic salmon): 106563493
Entry
106563493         CDS       T04363                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death-like
  KO
K02158  Bcl-2-antagonist of cell death
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563493 (BAD)
   04370 VEGF signaling pathway
    106563493 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106563493 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    106563493 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563493 (BAD)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106563493 (BAD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106563493 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 106563493
NCBI-ProteinID: XP_013984616
UniProt: A0A1S3L0Z2
LinkDB
Position
ssa11
AA seq 147 aa
MDYTHDCVDECESDHSGTTRNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDT
EFQDVMTPTEEGGGDGASFRGRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGI
IPRGGKQKVSRGWFSFLWSPKEAEGRE
NT seq 444 nt   +upstreamnt  +downstreamnt
atggactacacacatgattgtgtggatgaatgtgagtctgatcactcaggaaccacacgc
aactcagaattccagctccatgtctcaactacaatgagcaacagaccaagaccaggtgag
cgagtccggctctactcagagtcccaggtgtgctcccaggttggcaaaagggaagacaca
gagtttcaggatgtgatgactcctactgaggagggtgggggtgatggggcttcattccga
ggtcgatcacagtctgctcctcctgcactatgggctgcaaagaaatatggctgccagctg
aggaggatgagtgatgaatttgacacctggctcgacaaaggggtgcccaagagagggatt
atcccaagaggaggcaagcagaaagtctcccgaggatggttctctttcctctggagtcca
aaggaggcggaaggcagggagtga

KEGG   Salmo salar (Atlantic salmon): 106578087
Entry
106578087         CDS       T04363                                 

Definition
(RefSeq) bcl2-associated agonist of cell death-like
  KO
K02158  Bcl-2-antagonist of cell death
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106578087
   04370 VEGF signaling pathway
    106578087
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106578087
  09143 Cell growth and death
   04210 Apoptosis
    106578087
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106578087
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106578087
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106578087
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 106578087
NCBI-ProteinID: XP_014012152
UniProt: A0A1S3N9Q3
LinkDB
Position
ssa18
AA seq 158 aa
MAQIFTISDSESEEVGETENDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQ
ELQGRGPGVEGMPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVK
SAGAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSSE
NT seq 477 nt   +upstreamnt  +downstreamnt
atggctcagatatttactatatcagacagtgagtcagaggaggtaggagaaaccgaaaat
gaccaatcgtctgccggaaaggggatgactggcggtccaataggccacgccctcactgtg
cctgagatgagactggcaggagagggtcggttgaggatgaactcagagtcccaggcccag
gagctccagggtagggggccaggggtggaaggcatgcccacagatggagcatctttccgg
ggtcgctcccagtcggccccccctgccctctgggcggccaagagatacgggcggcagctc
cgacgcatgagtgacgagtttgatacgtggctggataaaggggagatgaggcgggtgaag
agtgcgggagcagccaaacagatgaccaagtcccccagctggtgggcctacctgttcagt
cataaggagacagagacagaacatacccctaccatcccaccacgatcatctgagtag

KEGG   Salmo salar (Atlantic salmon): 106603152
Entry
106603152         CDS       T04363                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death-like
  KO
K02158  Bcl-2-antagonist of cell death
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106603152 (BAD)
   04370 VEGF signaling pathway
    106603152 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106603152 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    106603152 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106603152 (BAD)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106603152 (BAD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106603152 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 106603152
NCBI-ProteinID: XP_014051932
UniProt: B5X1T1
LinkDB
Position
ssa04
AA seq 156 aa
MDHTHDCVDDNPETMNEHDESDHSGTTHYPEFQRHYVSTRTGIRPRPGGRVRLYSESQVC
SQVGRRDNTEFQDVMTPTEEGGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWL
DKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggaccacacacatgattgtgtggatgacaacccagaaaccatgaatgaacatgatgag
tctgaccactcaggaaccacacactacccagaatttcagcgccattatgtctccactagg
acgggcatcagaccacgaccaggtgggcgagtgcggctctactccgagtcccaggtgtgc
tcccaggttggcagaagggacaacacagagtttcaggatgtgatgactcctactgaggag
ggcggtggcgatggggctcctttccgaagccgatcacagtctgctcctcctacactgtgg
gctgcaaagaaatatggccgccagctgaggaggatgagtgatgaatttgacacctggctc
gacaaaggggaacccaagagagggataagcccaggaggggtcaagcaggaggtctcccga
ggatggttctctttcctctggagtccaaaaaaggctgaaggcagggagtga

DBGET integrated database retrieval system