KEGG   Salmo salar (Atlantic salmon): 106563612
Entry
106563612         CDS       T04363                                 

Definition
(RefSeq) probetacellulin-like
  KO
K09783  betacellulin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563612
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106563612
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106563612
SSDB
Motif
Pfam: PRIMA1 WBP-1 EphA2_TM TMEM154 EGF PAG Sarcoglycan_2 FAM163 Stevor DUF948 Cadherin_C_2 Shisa
Other DBs
NCBI-GeneID: 106563612
NCBI-ProteinID: XP_013984817
UniProt: A0A1S3L1I6
LinkDB
Position
ssa01
AA seq 188 aa
MAKAYKLYVGIATALALCKCSLAEWNATEETASKTVSRHHQGNTNNFTDSIETATQAKWS
GHFTKCPKEFRNYCIHGSCRFVKEHDTPSCRCEKGYIGSRCEYVDLAWRIGDQRQIIIAC
VIAALVFLILLIIFICICAHRHKLCRRKRRRKEETRNGTEKLNMIMMNTNGTHGASSDSV
ETSDINAI
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcaaaggcatacaaactgtatgtcggaatagccacagctttggccctatgcaaatgc
tctctggctgaatggaatgcaactgaggagacggccagcaagactgtgtcccgccatcac
caaggcaacacaaacaacttcacagactcaatagaaactgcaactcaagccaaatggagc
ggccatttcaccaaatgtccaaaggagttcaggaattactgtatccatgggtcgtgccgc
tttgtgaaggaacatgacactccttcatgcagatgtgaaaaagggtacattgggtccagg
tgtgagtatgttgatttggcctggcgtataggagaccagaggcagatcatcatagcctgt
gtgatagcagcgttggtcttcctcatactgctcatcatattcatctgcatctgtgcacat
cgacataaactttgcaggcggaagaggagaaggaaagaggagacgaggaatggaacagag
aagctcaatatgatcatgatgaacacaaatggaacacatggagcttcatcagattcagta
gaaacctcagacatcaatgcaatatga

KEGG   Salmo salar (Atlantic salmon): 106568258
Entry
106568258         CDS       T04363                                 

Definition
(RefSeq) probetacellulin-like
  KO
K09783  betacellulin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106568258
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106568258
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106568258
SSDB
Motif
Pfam: EGF PRIMA1 EphA2_TM FAM163 Sigma_reg_N WBP-1 PAG Baculo_11_kDa TMEM154 Shisa Conotoxin LRRC37AB_C
Other DBs
NCBI-GeneID: 106568258
NCBI-ProteinID: XP_013993901
UniProt: A0A1S3LSQ1
LinkDB
Position
ssa13
AA seq 189 aa
MAKAYNLYVGMVTALALCKYSLAELNTTEQPANNTVSLHHQGNTNNFKDSIETATQAKKS
GHFTKCTKELRQYCIHGSCRFVKEQNTPSCRCERGYIGSRCEYVDLASRLGDKRQIIVVC
VIAALVFLILLITFICICAHRHKLCRRKRKRKEETRNGTEKLNMIMMMNTNVMHVASSDS
VETSDTNAV
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcaaaggcatacaatctgtatgtaggaatggtaacagctttggccctgtgtaaatac
tctctggctgaattgaatacaactgagcagccagcgaacaacactgtgtccctccatcac
caaggcaacacaaacaacttcaaagactcaatagaaactgcaactcaagccaaaaagagc
ggccatttcaccaaatgtacaaaggagttaaggcaatactgtatccatgggtcgtgtcgc
tttgtaaaggaacagaatactccttcatgcagatgtgagagagggtacattgggtccagg
tgtgagtatgttgatctggcctcgcgtctaggtgacaagaggcagatcatcgtagtctgt
gtgatagcagcgttggtcttcctcatactgctcatcacattcatctgcatctgtgcacat
cgacataaactttgcagacggaagaggaaaaggaaagaggagacgaggaatggaacagag
aagctcaatatgattatgatgatgaacacaaatgtaatgcatgtagcttcatcagattca
gtagaaacctcagacaccaatgcagtatga

DBGET integrated database retrieval system