KEGG   Salmo salar (Atlantic salmon): 106563632Help
Entry
106563632         CDS       T04363                                 

Definition
(RefSeq) carbonyl reductase [NADPH] 1-like
  KO
K00079  carbonyl reductase 1 [EC:1.1.1.184 1.1.1.189 1.1.1.197]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00590  Arachidonic acid metabolism
sasa00790  Folate biosynthesis
sasa00980  Metabolism of xenobiotics by cytochrome P450
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106563632
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106563632
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106563632
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.184  carbonyl reductase (NADPH)
     106563632
    1.1.1.189  prostaglandin-E2 9-reductase
     106563632
    1.1.1.197  15-hydroxyprostaglandin dehydrogenase (NADP+)
     106563632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2
Motif
Other DBs
NCBI-GeneID: 106563632
NCBI-ProteinID: XP_013984862
UniProt: A0A1S3L1N2
LinkDB All DBs
Position
ssa11
AA seq 167 aa AA seqDB search
MRTNFWGTLWVCHALIPLLRPNARVVNVSSFVSKKALDTCGPQLQAKFRDTELSEEELCL
LMGQFVIAAQQGNHQAQGWPNTAYGTTKIGVTVLSRIQAHILTKTRAADGILLNACCPGW
VRTDMAGSKAPKSPEEGAQTPIYLALLPEVAKEPHGQLVWDKTVQQW
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccaacttttggggcaccctgtgggtgtgccatgctctcatacccctcctcaga
ccaaatgccagagtggtgaatgtctccagctttgttagcaagaaggctcttgatacatgc
ggccctcaactacaagccaagttccgtgatactgagctctctgaggaggagctgtgcttg
ctgatggggcagtttgttattgctgctcagcagggaaaccatcaggcccaggggtggcca
aacacagcctatggcacaacaaagattggagtgactgtgctgtccaggattcaggctcat
attctgactaagacccgggcagctgatggaatcctactcaatgcctgctgccctggctgg
gtccgcactgacatggcaggctccaaggcccccaagagtcctgaagaaggagcacagact
cctatctatctggcacttcttcctgaagtggccaaggagccacatggacagttggtgtgg
gacaagaccgttcagcaatggtag

DBGET integrated database retrieval system