KEGG   Salmo salar (Atlantic salmon): 106563662
Entry
106563662         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform-like
  KO
K05456  neuregulin 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563662
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106563662
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106563662
SSDB
Motif
Pfam: Neuregulin EGF Neur_chan_memb Saf_2TM
Other DBs
NCBI-GeneID: 106563662
NCBI-ProteinID: XP_013984906
UniProt: A0A1S3L1R2
LinkDB
Position
ssa11
AA seq 653 aa
MDLDVCVHPFPVLRSEEGAEGGTRLGCLALRGPPRRGCRWGFGAVRGLLLLLPTLLLLIL
GLGACLLLLRRALAQGSTSTGSKSPGHLDLRGGDEEESYPLTYTTATPNRAGTANGATGA
FESRALQGTSLSAAGSLLQPTPGLIVPTLLPTQPALLPASASTPPLLLLLLLITTTPSPG
SGHARRCNDSEKAYCVNGGDCYFINGINQFSCKCPNDFTGDRCQNYVMASFYQHLGIEFM
EAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKRQRKKMHNHLQQNMCADHPNRNLAN
GPNHPGPGPEEIPMVDYISKNVPATERVIGHVPEDSFPGSHASSRSHNSSTHAHSSTHRH
EERTWSLERTDSVLSDSPGMMSSSVGTSRCNSPACMEARARRAAHCGSTVPHRPGLQYED
SFDSLGDSPHSDRYVSALTTPARLSPVDFFYSLPPQVPTFQITSPNTSQAMSLPPAAHTP
YPLEDDHPLLRRYQVPLHDVQRQEPYRQQRRTYLNDSTGSLASSPYRLAEEEDYETTQEY
LSSREQPKKSGTGNGGVGGRRLRRSRLNGYVAPRGYEASRDYGSRSCLTDSESEEGESTP
FLSMQNMNAEPSTICRPANSRTSQSHSSGRHDARGTVQTRQTHSRSKPDNVPH
NT seq 1962 nt   +upstreamnt  +downstreamnt
atggacctggatgtctgtgtgcatccattccctgtgctgaggtctgaggagggggccgag
ggcggcaccagactgggttgccttgcgttgcgtggccctccccggcggggctgcagatgg
ggctttggggccgtgaggggtctcctcttgctcctccccaccctcctcctgctcatcctg
ggcctgggtgcctgtctcctgctgctgcgccgggcgctagctcagggctccacatccaca
ggctctaagtcccccggtcacctggatctgagggggggagatgaagaggagagttatcca
ctgacatacactacagctacaccaaacagagcaggaaccgccaacggggccaccggggcc
tttgaaagtagggcactccagggaacatccctctccgctgcaggctctctgctccagcca
acacctggcctgattgtacccactctgctgcccacccaacctgcactgctgccggccagc
gccagcacaccacccctcctcctcctcctcctcctcataactaccacgccgtctccaggc
tcgggccatgccagaagatgcaatgactcagagaaggcctactgcgtgaacggcggtgac
tgttacttcataaatggtatcaatcagttctcctgcaagtgtccgaatgactttactggt
gatcgctgtcaaaactacgtcatggccagtttctaccagcatcttgggattgaatttatg
gaagcggaagagctctaccagaaaagagtcctgacaatcacggggatctgcgtggctctg
ttggtggtgggcattgtgtgtgtggtggcctactgcaaaaccaagagacagaggaagaag
atgcacaatcacctgcagcagaacatgtgtgcagatcaccctaaccggaacctagcgaat
ggacccaatcacccaggacctggtcctgaggagatacccatggtagattacatctctaag
aatgtgcctgcaacggagcgagtcatagggcatgtaccagaggactcgttccccggcagc
catgcgtcttccagatctcacaactcctctacccatgcccattcatccactcacagacac
gaggagcggacatggagcctggaacggactgacagtgtcctctcagactcaccaggcatg
atgtcgtcctccgtggggaccagtaggtgcaacagtcctgcgtgcatggaggccagggcc
aggcgtgccgcacactgtggctctactgtgccccaccggccgggcctgcagtatgaagac
tcgttcgattcgctgggggactctccacacagcgacaggtatgtgtcagccctgacaacg
ccggcccgcctctctccagtggacttcttttactcgctgcccccgcaggtgcctaccttc
cagatcacctcccccaacaccagccaggccatgtccctgccacccgccgcccacaccccc
taccccctggaggacgaccaccctctgctgcggcgctaccaggtgccactgcacgacgtc
cagcgccaggagccctaccggcagcagcgccgcacctacctgaacgacagcacgggcagc
ctggcctctagtccctacaggctggctgaggaagaagactacgagaccacacaggagtac
ctctcctcccgtgaacaaccaaagaaaagtgggaccggcaatggtggtgttgggggtcgg
cgcttgcggaggtccagactgaacggctacgtagcgccgagaggatacgaggcgtcacgg
gactacggctctcgcagctgcctgacggacagtgagtcggaggagggcgagagcacgccc
ttcctcagtatgcagaatatgaacgcggagccctccaccatctgcaggccggccaacagt
cggacttctcagtcacactcttcggggcggcacgatgcacgcgggactgtacagaccaga
cagacacactcacggtccaaaccggacaatgtaccccattaa

KEGG   Salmo salar (Atlantic salmon): 106602814
Entry
106602814         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform-like
  KO
K05456  neuregulin 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106602814
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106602814
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106602814
SSDB
Motif
Pfam: Neuregulin Saf_2TM Neur_chan_memb
Other DBs
NCBI-GeneID: 106602814
NCBI-ProteinID: XP_014051180
UniProt: A0A1S3RFV5
LinkDB
Position
ssa04
AA seq 550 aa
RYTKQSRDGRWDRKRGPWVLLKVGHSGPSLSAAGPLLQPTPGLTIPILLYTQPALLPDSA
STQLLLLITTTLSPGSGHARRCNDTEKDYCVNGGDCYFIHGINQLSCKCPNDFTGDRCQN
YVMASFYQHLGIEFMEAEELYQKRVLTITGICVALLVVGIVCVVAYCKTKKQRKKMHNHL
RQNMCADHPNRNLANGPNHPGPGPEEIPMVDYISKNVPATERVIRHGTVASFPGSHASSR
SHNSYTHARSSTHRHEERTWSLERTDSVLSDSPGMMSSSVGTSKCNSPACMEARARRAAH
CGFTVPHRPGLQYGDSFDSLGDSPHSDRYVSALTTPARLSPVDFHYSLPPQVPIFQITSP
NTSQAMSLPPAAHTRYPLEDDQPLLRRYQVPLHDVQRQEPYRQQRRTYLNDSTGSLPSSP
YRLAEEEDYETTQEYLSSREQPKRTGSGSGGGGGRRVRRSRLNGHVAPRGYEASRDYGSR
SCLTDSESEEEEGESTPFLSMQNMNAEPSTIYRPADSRTSQSHSTGRHGARGNVQTRQTH
SRSKPDNAPH
NT seq 1653 nt   +upstreamnt  +downstreamnt
agatacaccaaacagagcagggacggcaggtgggaccgcaaacggggcccctgggtcctc
ctgaaagtaggacactcgggaccatccctctccgctgcaggccctttgctccagccaaca
ccaggcctgactatacccattctgctgtacacccaacctgccctgctgcctgacagtgcc
agcacccagctcctccttctcataaccaccacactatcgccaggctctggccacgccaga
agatgcaacgacaccgagaaggattactgcgtgaacggcggcgactgttactttatacat
ggtatcaatcagctctcctgcaagtgtccgaatgactttactggcgaccgctgtcaaaac
tacgttatggccagtttctaccagcatcttgggattgaatttatggaggcggaggagctc
tatcagaaaagagtcctgacaatcacggggatctgcgtggctctgttggtggtgggaatt
gtgtgtgtggtggcctactgcaaaaccaagaaacagaggaagaagatgcacaatcacctg
cggcagaacatgtgtgcggatcaccccaaccggaacctagcgaatggacccaatcaccca
ggaccaggccccgaggagatacccatggtagattacatctcaaagaatgttcctgcaacg
gagcgtgtcatacggcatggaacagtggcttctttccctggcagccacgcgtcttccaga
tctcacaactcctacacccatgcccgttcatccactcacagacacgaagagcggacgtgg
agcctggagcggactgacagtgtcctctcggactcgccgggcatgatgtcgtcctccgtg
gggaccagtaaatgcaacagtcctgcgtgcatggaggcccgggccaggcgtgccgcacac
tgtggctttactgtgccccaccggccgggcctgcagtacggagactcgttcgactcgctg
ggggactcgccacacagcgacaggtatgtgtcagccctgacgacgccggcccgcctctct
ccagtggacttccattactcactgcccccgcaggtgcctatcttccagatcacctccccc
aacaccagccaggccatgtccctgccgccagccgcccacacccgctaccctctggaagat
gaccagcctctgctgcggcgctaccaggtgcccctgcacgacgtccagcgccaggagccc
taccggcagcagcgccgcacctacctgaacgacagcacgggcagcctgccctccagcccc
taccggctggctgaggaagaagactacgagaccacgcaggagtacctgtcctcccgagag
caaccaaagagaactgggtctggcagcggtggtggtgggggtcggcgcgtgcggaggtcc
aggctgaacggccacgtagcgccgcgaggatacgaggcatcacgggactacggctctcgc
agctgcctgacggacagcgagtcggaggaggaagagggcgagagcacgcccttcctcagt
atgcagaatatgaacgcggagccctccaccatctacaggccagccgacagtcggacttct
cagtcgcactctacggggcggcacggtgcacgcgggaacgtacagaccagacagacgcac
tcgcggtccaaaccggacaatgcgccccactaa

KEGG   Salmo salar (Atlantic salmon): 106603019
Entry
106603019         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform-like
  KO
K05456  neuregulin 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106603019
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106603019
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106603019
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_4 Ig_6 Ig_5
Other DBs
NCBI-GeneID: 106603019
NCBI-ProteinID: XP_014051597
UniProt: A0A1S3RIB9
LinkDB
Position
ssa04
AA seq 301 aa
LVFPHCKIIGKSSGSRWHGHLRKVCRAAVLLEPICSLFLQPSSTAIAPQPREPCRNAISH
HRAKAGGMRLDSVHLSMLVIGVSFACYSPSLNSLQDQAYKSAVVIEGKVQSAPLNVSAEP
YRVSVKVLDVWPRNSGGLGREQLVTVGEFGSEAPCTTVIKNHKYIFFMDPTEDPLVFKAS
YAPLDTSGKNLKKDVGKILCENCAIAPKLKRMRNPLMVDEGSRLMVKCEATGNPSPTYKW
FKDGSELKKSREVKIKSSQKNSRVQISRAKLEDSGNYTCVAENLLGNSNSTSTVHVQSSE
Y
NT seq 906 nt   +upstreamnt  +downstreamnt
ctggtgtttccacattgcaaaattattggaaaaagcagcggatcccgatggcatggacac
ttacgcaaggtctgccgcgccgccgtgctactggagcctatttgctctctcttccttcaa
cccagctccaccgccatcgccccgcagcccagagagccctgccgcaacgcgatcagccac
caccgagccaaagcaggcggcatgaggcttgattcagtacatttatccatgctggtcatc
ggggtctccttcgcctgctactccccgagtttgaattccctgcaggaccaggcttacaaa
tccgctgtggtgatcgagggcaaggtgcagtctgcgcctctgaacgtctcagcggagccg
taccgtgtgagtgtcaaagtgctggacgtgtggccgcggaacagcgggggtctgggacgg
gagcagctcgtcaccgtgggggaattcggatcggaggctccgtgcaccacagtgataaag
aatcacaagtacatttttttcatggacccaaccgaggatcccttggttttcaaggcatcg
tatgctcccctagacactagtgggaagaatctaaaaaaagatgttgggaagatattgtgt
gaaaactgcgctattgccccaaagttaaagcgaatgaggaacccactgatggtggacgag
ggaagcaggctcatggtcaaatgtgaggctacagggaaccccagccctacctacaaatgg
ttcaaagatggcagtgagctcaagaaaagcagagaggtcaaaataaagtccagccagaag
aactccagggtccagatcagcagagccaagctggaggattctgggaattacacgtgtgtg
gcagagaaccttctggggaactccaactccaccagcactgttcatgtccaaagcagtgag
tactga

KEGG   Salmo salar (Atlantic salmon): 106604398
Entry
106604398         CDS       T04363                                 

Definition
(RefSeq) pro-neuregulin-2, membrane-bound isoform-like
  KO
K05456  neuregulin 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106604398
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106604398
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106604398
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 Ig_2 ig V-set Ig_5 SIT
Other DBs
NCBI-GeneID: 106604398
NCBI-ProteinID: XP_014054452
UniProt: A0A1S3RRJ9
LinkDB
Position
ssa05
AA seq 713 aa
MRLDPVHFSMLVIGVSFACYAPSLNSLQDQAYRSAVVIEGEVRSSPENVSREPYSVNVKV
LDVWPVNSGGLEREQLVTVGDFGSEAPCTTVEENHRYIFFMDPTGEPLVFKASFAPLDAS
GTDLKKDVESVLCEDCAVAPKLRPMRGQSLMEGERLYLKCEASGNPSPSFRWYKDGRELQ
RGKDIKIKTNKKNSKVQINRARLEDSGNYTCVVENMLGQESTTSSISVQSLTTTLSPGSS
HARRCNDTEKSYCVNGGDCYFIHGINQLSCKCPNDYTGDRCQKSVMAGFYKHLGIEFMEA
EELYQRRVLTITGICVALLVVGMVCVVAYCKTKKQRKKIHGHLNQNVNQNQCVEQPNRML
ANGPNHPGPGPEEIPMVDYISKNAPTTECSIIQHGPEEAVNYAGSRMSTRSHHSSTASHN
SRHEERTWSIERTDSMNSDCQSGALSSSVGTSKCSSPTCMEARARRAAYWGCSEGASLQY
GDSYDSLRDSPHSDRYVSALTTPARLSPIEFHYPPLPPQVPTFQITSPNTGHALALPPAA
AAYQRDDDQPLLRCPQDGRLYRQPRRPRQPYLTESTGSLPSSPYHLPDDEAYETTQEYAS
SREPIRSRRRPRRNRLNGHVSQRAMGLRDNSSQSFSQSEEEEEEEEGQGESTPFLSMQNM
NMEPCERGYRSSTAPAPTADIRTHRAQGRPSTRSNGHSKSSQSRSSKNDNAPL
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgaggcttgatccggtgcatttctccatgctggtcatcggggtctccttcgcctgttac
gccccgagtctcaattccctccaggaccaggcgtatcgatctgccgtggtcatcgagggc
gaggtgcgctcctcaccggaaaacgtctctcgggagccttacagtgtaaatgtcaaagtg
ctggacgtgtggcccgtgaacagcggcgggctcgagcgggagcagctcgtgactgtcgga
gacttcggttccgaggccccgtgcaccaccgtggaggagaaccacagatatatatttttc
atggacccaacaggcgagcctttagtattcaaggcatcgtttgctccgctggacgccagc
ggaacggacctgaagaaggatgtggagagcgtgttgtgtgaggactgcgctgtggcccct
aagttgcggccgatgcggggccagtctctaatggagggggagcggttgtatctgaagtgt
gaggcgtcagggaaccccagcccctccttccgatggtataaagatggccgagagctccag
aggggaaaagacatcaaaatcaagaccaataagaaaaactccaaggtccagatcaaccga
gcgaggctggaggattctgggaactacacgtgtgtggttgagaacatgctgggccaggag
agcactacgagcagcatcagtgtgcagagcctgaccactactctgtctccaggctcgagt
cacgcccggcgctgtaacgacacagagaagtcgtactgtgtgaacggtggagactgttat
ttcatacacggtataaaccaactgtcatgcaagtgtccaaatgactatacaggtgatcgc
tgtcaaaaatccgtcatggcaggtttctacaagcatcttggaattgaatttatggaggca
gaggagctgtaccagcggcgggtgttgaccatcacaggcatctgtgtggcactgttggta
gtgggcatggtctgtgtggtggcatactgcaaaaccaagaaacagaggaagaagatacat
ggccacctgaaccagaacgtcaaccagaaccagtgtgtggagcagcccaaccgcatgcta
gctaacgggcccaaccaccccgggccgggccctgaggagatccccatggtggactacatc
tcaaagaacgctcctactacagagtgtagtataatacagcatggaccagaagaagctgta
aactacgcaggaagccgaatgtccaccagatcccaccactcatctacagcctcccacaac
tccagacatgaggagcggacgtggagtatagagaggacagacagtatgaactcagactgc
cagtcgggggcactctcctcgtcagtgggcaccagtaaatgcagcagcccgacctgcatg
gaggcacgggcacggagggccgcctactggggctgttctgagggagccagcctgcagtat
ggagactcctacgactctctgagagactcacctcacagtgacaggtacgtgtcagcgttg
accacaccagcccgtctgtcgcccattgagttccactaccccccactgcccccccaagtg
cccaccttccaaatcacatcccccaacacaggccacgccctcgccctgccgcccgctgcc
gcagcctaccagcgggatgacgaccagcccttgctgagatgcccccaggatggacggttg
taccggcagccccgtcgtccacgccaaccctacctgacagagagcacgggcagccttcca
tccagcccctatcatctccctgacgacgaggcctacgagaccacgcaggagtacgcctcc
tcccgtgaaccaatcaggagccgccggcgcccacgtcggaaccgcctcaatggacatgtc
tcccagcgtgcaatgggcctacgggacaacagctctcagagcttcagccaatcagaggag
gaggaggaggaagaggaggggcaaggagagagcactcctttcctcagtatgcagaacatg
aacatggagccgtgcgaacgtgggtaccgatcatctactgcccctgccccgaccgccgac
atacggactcaccgggcgcaggggcggccaagcacccgcagcaacggacacagtaaaagc
tcccagtcgcgctcctccaaaaatgacaacgcacccctttaa

KEGG   Salmo salar (Atlantic salmon): 106612118
Entry
106612118         CDS       T04363                                 

Gene name
nrg2
Definition
(RefSeq) neuregulin 2
  KO
K05456  neuregulin 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106612118 (nrg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106612118 (nrg2)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106612118 (nrg2)
SSDB
Motif
Pfam: Neuregulin I-set Ig_3 Ig_2 ig V-set C2-set_2 Ig_5 SIT Saf_2TM
Other DBs
NCBI-GeneID: 106612118
NCBI-ProteinID: XP_014068479
UniProt: A0A1S3SVW5
LinkDB
Position
ssa09
AA seq 569 aa
MRLDPVHFSMLVIGVSFACYAPSLNSLQDQAYRSAVVIEGEVRSSPENVSRDPYSVNVKV
LDVWPVNSGGLEREQLVTVGDFGSEAPCTTVEENHRYIFFMDPTGEPLVFKASFAPLDAS
GTDLKKDVESVLCEDCAAAPKLRPMRGQSLMEGERLYLKCEASGNPNPSFQWYKDGRELQ
RGKDVKIKTNKKNSKVQITRARLEDSGNYTCVVENTLGQENATSSISIQSLTTTLSPGSS
HARRCNDTEKSYCVNGGDCYFIHGINQLSCKCPNDYTGDRCQKSVMAGFYKHLGIEFMEA
EELYQRRVLTITGICVALLVVGMVCVVAYCKTKKQRKKMHGHLNQNVNQNQCVEQPNRML
ANGPNHPGPGPEEIPMVDYISKNAPTTECSIIQHGPEESVNFAGSRMSTRSHHSSTVSHN
SRHEERTWSIERTDSMNSDFQSGALSSSVGTSKCSSPTCMEARAQRAAYWGCSEGASLQY
GDSYDSLRDSPHSDRYVSALTTPARLSPVEFHYPPLSPQVPTFHITSPNTGHALSLPPAA
VAYHREDDQPLLRCPQVTMTLPLHPLVTT
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaggcttgatccggtccatttctccatgctggtcatcggggtctctttcgcctgttac
gccccgagtctcaattccctccaggaccaggcataccgatccgccgtggtcatcgagggc
gaggtgcgctcctcaccggaaaacgtctctcgggacccgtacagtgtgaatgtcaaagtg
ctagacgtatggcccgtgaacagcggcggactcgagcgggagcagctcgtgaccgtcggg
gacttcggttccgaggccccgtgcaccactgtagaggagaaccacagatatatatttttc
atggacccaacaggcgagcctttagtattcaaggcatcgtttgctccgctggacgccagc
ggaacggacctgaagaaggatgtggagagcgtgttgtgtgaggactgcgctgcggcccct
aagttgcggccgatgcggggccagtctctaatggagggagagaggctgtatctgaagtgt
gaggcgtcagggaaccccaacccctccttccagtggtacaaagacggccgcgagctccag
aggggaaaagacgtcaaaatcaagaccaataagaaaaactccaaggtccagatcacccga
gcgaggctggaggattctgggaactacacgtgtgtggttgagaacacgctgggccaagaa
aacgctacgagcagcatcagcatccagagcctgaccactactctgtctccgggctcgagt
cacgcccggcgctgtaacgacacagagaagtcgtactgtgtgaacggtggagactgttat
ttcatacacggtataaaccaactgtcatgcaagtgtccaaatgactatacaggtgatcgc
tgtcaaaaatccgtcatggcaggtttttacaagcatcttggaattgaatttatggaggca
gaggagctgtaccagcggcgggtgttgaccatcacaggcatctgtgtggcactgttggta
gtgggcatggtctgtgtggtggcatactgcaaaaccaagaagcagaggaagaagatgcat
ggccacctgaaccagaacgttaaccagaaccagtgtgtggagcagcccaaccgcatgctg
gctaacggtcccaaccaccccgggccaggccctgaggagatccctatggtcgactacatc
tcaaagaacgctcctaccacagagtgtagtattatacagcatggaccagaagaatccgta
aacttcgcaggaagccgaatgtccaccagatcccaccactcatctacagtctcccacaac
tccagacatgaggagcggacgtggagtatagagaggacagacagtatgaactcagacttc
cagtcaggggcgctctcctcgtcagtgggcaccagtaaatgcagcagcccgacctgcatg
gaggcacgggcacagagggccgcctactggggctgttctgagggagccagcctgcagtat
ggagactcctacgactctctgagagattcacctcacagcgacaggtatgtgtcagcgttg
accacgccagcccgtttgtcacccgtcgagttccactaccccccactgtccccccaggtg
cccaccttccacatcacctctcccaacacgggccacgccctctccctgccgcccgccgct
gtagcctaccaccgggaggacgaccagcccctgctaagatgcccccaggtgaccatgacc
ctgccgctacacccactagtgactacgtga

DBGET integrated database retrieval system