KEGG   Salmo salar (Atlantic salmon): 106563964
Entry
106563964         CDS       T04363                                 

Gene name
chek1
Definition
(RefSeq) checkpoint kinase 1
  KO
K02216  serine/threonine-protein kinase CHEK1 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563964 (chek1)
   04115 p53 signaling pathway
    106563964 (chek1)
   04218 Cellular senescence
    106563964 (chek1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106563964 (chek1)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106563964 (chek1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106563964 (chek1)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   106563964 (chek1)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106563964 (chek1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 106563964
NCBI-ProteinID: XP_013985396
UniProt: A0A1S3L363
LinkDB
Position
ssa11
AA seq 454 aa
MAVPFVQDWDLIQTLGEGAYGEVRLLVNRQTGEAVAVKVIDTSQGKECSENVKKEICINK
VLSHPNVVRFFGHRREGPTVYLFLEYCSGGELFDRIEPDLGMPEREAHRFFQQLIAAVEY
LHSVGITHRDIKPENILLDDKDNLKLSDFGLATMFRHRGRERRLNRLCGTLPYVAPELLS
KSEFSAQPADVWACGIVLTAMLAGELPWDQPSESCQEYSDWLQKKTYLSPWKKIKHTPLS
LLSKLLQALPEERLSISDLKTDPWFIQTFTPVASHNNLLRSDRLLLHRNNSDRVQFSSSQ
PDPALGVWEGSVCVGVPDQVSFSQPARPDNMLLGSQLLGTPGPSQTPWQRLVRRMTRFFT
TLDSSASCSALRDTCIDLGHTFKHTCTNQVTVSTLDRRNNKLIFKVHLMELDERVLLDFR
LSKGDGLEFKRLFLKIKQKLSDIISTQRIPLPVT
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggcggtgccttttgtgcaggactgggacctgatccagacgctgggagaaggagcatat
ggagaggtcaggctgctggtgaacagacagactggagaagctgtagcggtgaaggttatt
gatacgtctcaggggaaggagtgttctgagaacgtcaagaaagagatctgcatcaacaag
gttctgtcccatcctaacgtagtgcgtttcttcggccaccggagggaggggccgactgtc
tatctgttcctggagtactgcagcggtggagagctattcgacaggattgagcctgatttg
gggatgccagagagagaagctcacaggtttttccagcagttgatagcagctgtggaatat
ctccacagtgtaggtatcacccacagagacatcaagcctgagaacattctcctggacgat
aaagataacctgaagttgtcggacttcggtctagctacgatgttccgtcaccgtgggcga
gagcggcgtctgaacaggctgtgtggaactcttccgtacgtcgcgcctgagctgctcagc
aaatcagagttcagcgctcaaccagctgacgtctgggcctgcggcatcgtcctcaccgcc
atgctggctggagagttgccgtgggaccagcccagcgagagctgccaggaatattctgat
tggctgcagaagaagacctacctctccccctggaagaagattaaacacacccccctcagc
ctactatctaaactactccaggctttgccagaagagaggctatctatctctgatctgaag
accgacccgtggttcattcagaccttcacacccgtagcctctcacaacaacctgctacgc
tctgacagactactactacacaggaacaacagtgatagggtgcagttctccagctcccag
ccagacccagcgctcggtgtgtgggagggaagtgtgtgtgtcggagtgccagaccaggtc
agcttctctcagccggccagaccagacaacatgctgctggggagtcagctactgggcacg
cctggacccagccagacaccgtggcagcggctggttcggaggatgacgaggttctttacg
actctggactcttcagcttcctgctccgctctgagggacacctgtatcgacctgggccac
accttcaaacacacctgcaccaaccaggtaaccgtcagtactctggatagacggaacaat
aagttgatatttaaggttcatctcatggagctggacgagagagttttacttgacttcaga
ctatccaagggcgatggtctggagtttaagcgtctcttcctgaagatcaaacagaagcta
agtgacatcatcagcacccagagaataccacttcctgtcacatga

DBGET integrated database retrieval system