KEGG   Salmo salar (Atlantic salmon): 106563990
Entry
106563990         CDS       T04363                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04150  mTOR signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563990
   04012 ErbB signaling pathway
    106563990
   04310 Wnt signaling pathway
    106563990
   04370 VEGF signaling pathway
    106563990
   04020 Calcium signaling pathway
    106563990
   04070 Phosphatidylinositol signaling system
    106563990
   04150 mTOR signaling pathway
    106563990
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563990
   04540 Gap junction
    106563990
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106563990
   04916 Melanogenesis
    106563990
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106563990
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     106563990
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   106563990
SSDB
Motif
Pfam: C2 Pkinase C1_1 PI3K_C2 PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 106563990
NCBI-ProteinID: XP_013985421
UniProt: A0A1S3L387
LinkDB
Position
ssa12
AA seq 294 aa
MKCDHCMMNIHKRCVSNVPSLCGTDHTERRGRIQITADIKDNKLTVYIQEACNLVPMDPN
GLSDPYVKLKLIPDPKSDTKQKTKTIKCNLNPTWNETFTFPLKDSDKDRRLSVEIWDWDL
TSRNDFMGALSFGVSELQKQGVDGWFKLLSQEEGEYFNVPVQPDGEDGNEELRQKFERAK
IGPGKNTDGSSSNSTSKYDSNGNQDRVKLTDFNFIMVLGKGSFGKVMLAERKGADELYAV
KILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMVNTHTHTHTHR
NT seq 883 nt   +upstreamnt  +downstreamnt
atgaaatgtgaccattgtatgatgaacatccataagcggtgtgtgtctaacgttcccagt
ctgtgtggaacagaccacactgagaggagaggacgcatccagatcaccgcagatatcaag
gacaacaaactcaccgtctacatccaggaggcttgtaacctggtccccatggaccctaac
ggtctgtctgacccctacgtgaagctcaaactcatccccgaccccaagagtgacaccaag
cagaagaccaagaccatcaagtgtaacctgaaccccacctggaatgagaccttcacattt
cctctgaaggactctgataaggaccggcgtctatcggtggagatctgggattgggatctg
accagcaggaacgacttcatgggagcgctctcattcggcgtctcagagctccagaaacaa
ggagtggatggatggtttaaattgttgtcccaagaggagggagagtactttaatgttcct
gtccaaccagacggagaggacggcaacgaggaactacgacagaagtttgagagggctaag
atcggtcctggtaagaacacagacggctcctcctctaactccacctctaagtacgatagc
aacggtaaccaggaccgtgtcaaactgacagacttcaacttcattatggtgttgggcaag
ggtagcttcgggaaggtgatgttagcagagcgtaaaggagcagacgagctgtacgccgta
aagatcctgaagaaggatgtggtgatccaggatgatgatgtggagtgtaccatggtggag
aagagagtcctggcgttgtccgggaaacctcccttcctcacacagctccactcctgcttc
cagaccatggtaaacacacacacacacacacacacacacaggg

KEGG   Salmo salar (Atlantic salmon): 106563994
Entry
106563994         CDS       T04363                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04150  mTOR signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563994
   04012 ErbB signaling pathway
    106563994
   04310 Wnt signaling pathway
    106563994
   04370 VEGF signaling pathway
    106563994
   04020 Calcium signaling pathway
    106563994
   04070 Phosphatidylinositol signaling system
    106563994
   04150 mTOR signaling pathway
    106563994
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563994
   04540 Gap junction
    106563994
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106563994
   04916 Melanogenesis
    106563994
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106563994
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     106563994
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   106563994
SSDB
Motif
Pfam: C1_1 C2 Pkinase C1_2 PI3K_C2
Other DBs
NCBI-GeneID: 106563994
NCBI-ProteinID: XP_013985431
UniProt: A0A1S3L396
LinkDB
Position
ssa12
AA seq 481 aa
MRRSAHTPAARRHSCSSAAQSPSEQGSRAHGESGTRQCEAWQESGHSHRANTGGKPTPTE
EEGREAPAEKAPTLSFLLISKHFRVKMADREQGSSDGESSSTGGSERRESGAARGFARQG
ALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTF
SCPGADKNASDDPRSKHKFKVHTYSSPTFCDHCGSLLYGLIHQGMKCDHCMMNIHKRCVS
NVPSLCGTDHTERRGRIQITADIKDNKLTVYIQEACNLVPMDPNGLSDPYVKLKLIPDPK
SDTKQKTKTIKCNLNPTWNETFTFPLKDSDKDRRLSVEIWDWDLTSRNDFMGALSFGVSE
LQKQGVDGWFKLLSQEEGEYFNVPVQPDGEDGNEELRQKFERAKIGPGKNTDGSSSNSTS
KYDSNGNQDRVKLTDFNFIMVLGKGSFGKVMLAERKGADELYAVKILKKDVVIQDDDVEC
T
NT seq 1445 nt   +upstreamnt  +downstreamnt
atgaggcgctccgctcacacaccagcagcacgtcgccacagctgtagcagcgctgcccag
tctccgagcgaacagggaagcagggcccacggggagtcggggacccggcagtgtgaggct
tggcaggagtccggacattcacaccgagcaaacaccggggggaaaccgacaccgacagag
gaagaagggagggaggcacctgctgaaaaggcaccaactctctctttcctcctcatttca
aaacacttccgcgttaaaatggctgaccgcgagcagggcagcagcgacggagagagctcg
agcaccgggggatccgagcggcgggagagcggggccgcgaggggcttcgcgcgccaagga
gctctgcgccagaagaacgtgcacgaggtcaaggaccacaagttcatcgcgcgcttcttc
aagcagcccacgttctgcagccactgcacggacttcatctggggtttcgggaagcaaggt
ttccagtgtcaagtgtgttgtttcgtggttcataaacgctgtcatgagttcgtcaccttc
tcctgtccgggggccgacaagaacgcatcagacgacccgaggagtaaacacaagtttaag
gtccatacctactccagccctacattctgtgaccactgtggatctctactttacgggttg
atacaccagggcatgaaatgtgaccattgtatgatgaacatccataagcggtgtgtgtct
aacgttcccagtctgtgtggaacagaccacactgagaggagaggacgcatccagatcacc
gcagatatcaaggacaacaaactcaccgtctacatccaggaggcttgtaacctggtcccc
atggaccctaacggtctgtctgacccctacgtgaagctcaaactcatccccgaccccaag
agtgacaccaagcagaagaccaagaccatcaagtgtaacctgaaccccacctggaatgag
accttcacatttcctctgaaggactctgataaggaccggcgtctatcggtggagatctgg
gattgggatctgaccagcaggaacgacttcatgggagcgctctcattcggcgtctcagag
ctccagaaacaaggagtggatggatggtttaaattgttgtcccaagaggagggagagtac
tttaatgttcctgtccaaccagacggagaggacggcaacgaggaactacgacagaagttt
gagagggctaagatcggtcctggtaagaacacagacggctcctcctctaactccacctct
aagtacgatagcaacggtaaccaggaccgcgtcaaactgacagacttcaacttcattatg
gtgttgggcaagggcagcttcgggaaggtgatgttagcagagcgtaaaggagcagacgag
ctgtacgccgtaaagatcctgaagaaggatgtggtgatccaggatgatgatgtggagtgt
accat

KEGG   Salmo salar (Atlantic salmon): 106564882
Entry
106564882         CDS       T04363                                 

Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04150  mTOR signaling pathway
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564882
   04012 ErbB signaling pathway
    106564882
   04310 Wnt signaling pathway
    106564882
   04370 VEGF signaling pathway
    106564882
   04020 Calcium signaling pathway
    106564882
   04070 Phosphatidylinositol signaling system
    106564882
   04150 mTOR signaling pathway
    106564882
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106564882
   04540 Gap junction
    106564882
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106564882
   04916 Melanogenesis
    106564882
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106564882
   04270 Vascular smooth muscle contraction
    106564882
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     106564882
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   106564882
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    106564882
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like APH
Other DBs
NCBI-GeneID: 106564882
NCBI-ProteinID: XP_013986843
UniProt: A0A1S3L7B1
LinkDB
Position
ssa12
AA seq 694 aa
MADVTQFNEGTGDVAKGFARKGALRQKNVHEVKDHKFTARFFKQPTFCSHCTDFIWGFGK
QGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRTKHKFKSHTYGSPTFCDHCGSLL
YGLIHQGMKCETCDMNVHNQCVMNVPSMCGTDHTERRGRLYLKCDITGDKLQVTVGEGRN
LIPMDPNGSSDPYVKLKLIPDPKNETKKKTKTIRANLNPTWNESFTFKLKPTDKDRRLSV
EVWDWDRTTRNDFMGSLSFGVSELIKSPVCGWYKMLNQEEGEYYNVPISEEDDGNEELRQ
KFEDCQINYHFLKGQAKDKASQVQKAKLGPGTKKVIAPSDDSRSNLPSNNLDSVKLTDFN
FLAVLGKGSFGKVILAEMKPTEDLYAIKILKKDVVIQDDDVECTMIEKRVLAQQDKPPFL
TSLHSCFQTVDRLYFVMEYVNGGDLMYHIQQAGKFKEPQAVFYAAEISVGLFFLHKKGII
YRDLKLDNVMLDSEGHIKIADFGMCKENIYEGVTTRTFCGTPDYIAPEIIAYQPYGLSVD
WWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKQMSKEAVSICKGLMTKHPSKR
LGCGSEGERDIREHAFFRRIDWERLQNREIQPPFKPKGCGKGAENFDKFFTRTQPQLTPP
DQLVIANIDQADFSGFSFINPQFIHPSLVSLHTV
NT seq 2085 nt   +upstreamnt  +downstreamnt
atggctgatgtcacgcaattcaacgaggggaccggggacgtcgcgaaagggttcgctcgt
aaaggagctttgaggcagaagaacgtccatgaagtgaaggaccacaaattcactgcaagg
ttcttcaagcagccgactttttgtagtcactgcaccgactttatctggggatttggaaag
caaggattccagtgccaagtttgctgtttcgtggtccacaagaggtgccatgagtttgtc
acgttctcttgccccggtgcggataagggtcccgacacagacgaccccagaaccaagcac
aagtttaagagccacacctatggcagccccactttctgcgaccactgtggctctctcctg
tatggtctcatccaccaggggatgaagtgtgagacctgcgacatgaatgtgcacaatcag
tgtgtgatgaacgtgccaagcatgtgcgggacggaccacaccgagaggaggggacgcctc
tacctgaagtgtgacatcacaggagacaagctgcaggtcacagtgggcgaaggtcgaaat
ctgatccccatggaccccaacggctcatctgacccttacgtcaagctcaagctcatccca
gaccccaagaatgagaccaagaagaagaccaagaccatccgcgccaacctcaaccccacc
tggaatgagtctttcacattcaagctgaagcctacagacaaggaccgcaggctgtctgtg
gaggtgtgggactgggaccggaccaccaggaacgacttcatgggctccctgtccttcggc
gtgtcagagctgatcaaatcgcctgtgtgtggctggtacaagatgttgaaccaagaggag
ggagagtactacaacgtgcccatatcagaggaggatgacggaaacgaggagctcagacag
aagtttgaggattgccaaattaactatcacttcctaaagggccaggccaaggacaaagcc
agccaagttcagaaagccaagctgggccctggtactaagaaggtgatcgctccatcagat
gacagcaggtctaatctgccctctaacaacctggactctgtcaaactcaccgacttcaac
ttcctggccgtgctggggaaaggcagcttcggcaaggtgattctggcagagatgaagccc
acagaggatctgtacgccatcaagatcctgaagaaggacgtggtgatccaggatgatgat
gtggagtgtaccatgatagagaagagagtcctggcccagcaggacaaaccacccttcctc
acctcactccactcctgcttccagaccgtggaccggctgtactttgtcatggagtatgtg
aatgggggagacctcatgtaccacatccaacaagcgggcaagttcaaagagccacaggca
gtgttctatgcagcagagatctctgttggcctgttcttcctgcacaagaaaggaatcatt
tacagggatctgaagctggacaacgtgatgctggactcggagggccacattaagattgct
gactttggcatgtgtaaagagaacatatacgagggagtgaccactcgcaccttctgtggg
acgcccgactacatcgccccagagattattgcataccagccatatgggctatcagtggat
tggtgggcatacggagtgctgctctatgaaatgttggcaggacagcccccgtttgatggt
gaggatgaggacgagctcttccagtccatcatggagcacaacgtgtcgtaccccaagcaa
atgtccaaagaggccgtgtccatctgcaaagggctgatgaccaaacacccgtcgaagcgt
ctgggctgcggctccgagggagagagggacatccgggagcacgccttcttcagacgcatc
gactgggaacgtctccagaaccgcgagatccaaccccccttcaagcccaaagggtgcggc
aaaggggcggagaacttcgacaagttcttcacgcgcacccagccccagctcacgccgccc
gaccagctggtcatcgccaacatcgaccaagctgacttctcaggcttctcattcatcaac
ccccagttcatacacccctccctggtctccctgcacaccgtatga

KEGG   Salmo salar (Atlantic salmon): 106593748
Entry
106593748         CDS       T04363                                 

Definition
(RefSeq) protein kinase C beta type-like
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04150  mTOR signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106593748
   04012 ErbB signaling pathway
    106593748
   04310 Wnt signaling pathway
    106593748
   04370 VEGF signaling pathway
    106593748
   04020 Calcium signaling pathway
    106593748
   04070 Phosphatidylinositol signaling system
    106593748
   04150 mTOR signaling pathway
    106593748
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106593748
   04540 Gap junction
    106593748
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106593748
   04916 Melanogenesis
    106593748
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106593748
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     106593748
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   106593748
SSDB
Motif
Pfam: C2 Pkinase C1_1 PI3K_C2 PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 106593748
NCBI-ProteinID: XP_014040599
UniProt: A0A1S3QMJ1
LinkDB
Position
Un
AA seq 283 aa
MKCDHCMMNIHKRCVSNVPSLCGTDHTERRGRIQITADIKDNKLTVYIQEACNLVPMDPN
GLSDPYVKLKLIPDPKSDTKQKTKTIKCNLNPTWNETFTFPLKDSDKDRRLSVEIWDWDL
TSRNDFMGALSFGVSELQKQGVDGWFKLLSQEEGEYFNVPVQPDGEDGNEELRQKFERAK
IGPGKNTDGSSSNSTSKYDSNGNQDRVKLTDFNFIMVLGKGSFGKVMLAERKGADELYAV
KILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTM
NT seq 849 nt   +upstreamnt  +downstreamnt
atgaaatgtgaccattgtatgatgaacatccataagcggtgtgtgtctaacgttcccagt
ctgtgtggaacagaccacactgagaggagaggacgcatccagatcaccgcagatatcaag
gacaacaaactcaccgtctacatccaggaggcttgtaacctggtccccatggaccctaac
ggtctgtctgacccctacgtgaagctcaaactcatccccgaccccaagagtgacaccaag
cagaagaccaagaccatcaagtgtaacctgaaccccacctggaatgagaccttcacattt
cctctgaaggactctgataaggaccggcgtctgtcggtggagatctgggactgggatctg
accagcaggaacgacttcatgggagcgctctcattcggcgtctcagagctccagaaacaa
ggagtggatggatggtttaaattgttgtcccaagaggagggagagtactttaatgttcct
gtccaaccagacggagaggacggcaacgaggaactacgacagaagtttgagagggctaag
atcggtcctggtaagaacacagacggctcctcctctaactccacctctaagtacgatagc
aacggtaaccaggaccgcgtcaaactgacagacttcaacttcattatggtgttgggcaag
ggcagcttcgggaaggtgatgttagcagagcgtaaaggagcagacgagctgtacgccgta
aagatcctgaagaaggatgtggtgatccaggatgatgatgtggagtgtaccatggtggag
aagagagtcctggccctgtcagggaaacctcccttcctcacacagctccactcctgcttc
cagaccatg

KEGG   Salmo salar (Atlantic salmon): 106594520
Entry
106594520         CDS       T04363                                 

Definition
(RefSeq) protein kinase C beta type
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04150  mTOR signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106594520
   04012 ErbB signaling pathway
    106594520
   04310 Wnt signaling pathway
    106594520
   04370 VEGF signaling pathway
    106594520
   04020 Calcium signaling pathway
    106594520
   04070 Phosphatidylinositol signaling system
    106594520
   04150 mTOR signaling pathway
    106594520
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106594520
   04540 Gap junction
    106594520
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106594520
   04916 Melanogenesis
    106594520
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106594520
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     106594520
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   106594520
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like APH RIO1
Other DBs
NCBI-GeneID: 106594520
NCBI-ProteinID: XP_014041366
UniProt: A0A1S3QN27
LinkDB
Position
ssa02
AA seq 284 aa
MVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYA
AEISIGLLFLHSKGIVYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDY
IAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKE
AVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWDKLENKEVQPPFKPKAKNRRDT
GNFDKEFTKMAVELTPTDKLFIMNLDQNEFQGFSYTNPEYIIQV
NT seq 855 nt   +upstreamnt  +downstreamnt
atggtggagaagagagtcctggcgttgtccgggaaacctcccttcctcactcagctgcac
tcctgcttccagaccatggacaggttatattttgtgatggagtatatcaacggaggagac
ctcatgtatcagatccagcaggtcggcaagttcaaggaaccccacgctgttttctatgca
gcggagatctccatcggcctcctcttcctccattccaaaggcatcgtttaccgggatctg
aagctggacaacgtgatgctggatgcagaaggccacattaagatagctgactttgggatg
tgtaaagagaacatgttagacggtgtcaccaccaagaccttctgtgggaccccagactac
atcgctcctgagatcatagcgtaccagccctatgggaagtccgtggactggtgggccttt
ggcgttctgctgtatgagatgctggctggacagcctccgtttgatggtgaggatgaggat
gagttgtttcagtccatcatggagcatcacgtctcctaccccaagtccatgtccaaggag
gctgtcgccatctgcaaagggttgatgactaagcacccagggaagcgtctgggctgtggt
ccggagggggagagggatataaaggaacatgccttcttccgttacatagactgggacaaa
ctggagaacaaggaagtccagccgcccttcaaacccaaagctaagaaccgtcgggacaca
gggaactttgataaagagttcactaagatggcagtggaactgactcctacagacaaactg
ttcataatgaacctcgatcagaacgaattccagggattctcctataccaacccagagtac
atcatacaggtttaa

DBGET integrated database retrieval system