KEGG   Salmo salar (Atlantic salmon): 106564229
Entry
106564229         CDS       T04363                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106564229
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106564229
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106564229
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    106564229
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 106564229
NCBI-ProteinID: XP_013985752
UniProt: A0A1S3L462
LinkDB
Position
ssa12
AA seq 256 aa
CISEWSGESGRNISICYGLIQYISSQLHSKMTNRRVVLLIAAIWGLAIFMGLVPTMGWHC
LCDLDNCSTMAPMYQRSYLVFWAVLNLFTFSLMVAAYTRIFVYVRHKSQRMSQHTSQIRH
KETVFNLMKTVSMILGCFVICWTPGLVLLMLDGLGCESCQVLRYEKYCLVLAECNSLVNP
IIYSFRDTDMLQTFKRILCCLCRRGGAGHKDTLSGTRCNTLEQEVLSESNGNNHHDNHND
DNNHISPHGDHSDTDD
NT seq 772 nt   +upstreamnt  +downstreamnt
atgtatatcagagtggtcgggagaaagcggtagaaacatttccatctgttatggactaat
acagtatatatcgtctcagctccacagtaagatgaccaaccgccgcgtggtgctgctcat
cgccgctatctggggcctagccatcttcatgggcctggttcccaccatgggctggcactg
tctgtgtgacctggacaactgctccaccatggcccccatgtaccaacgctcctacctggt
gttctgggctgtgctcaacctgttcaccttctctctcatggtggctgcctacaccaggat
ctttgtgtacgtcagacacaagagccagaggatgtctcagcacaccagccagatacgaca
caaggagactgtgttcaacctgatgaagactgtgtctatgatcctgggttgttttgtgat
ctgctggaccccgggcctggtgttgttgatgttggatggtctgggctgtgaatcgtgcca
ggtgctgcgttatgagaagtactgtctggtcctggctgagtgtaactccctggtcaaccc
catcatctacagcttcagagacacggacatgttacagaccttcaagaggatcctctgctg
cctgtgtcgccgcggcggcgccggccacaaagacacgctgtccggcacgcgctgcaacac
cctggagcaagaggtactctctgagagcaacggcaacaatcaccacgacaaccacaacga
cgacaacaatcatataagtccccacggcgaccactcggacacagacgattag

DBGET integrated database retrieval system