KEGG   Salmo salar (Atlantic salmon): 106564260
Entry
106564260         CDS       T04363                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564260
   04310 Wnt signaling pathway
    106564260
   04340 Hedgehog signaling pathway
    106564260
   04371 Apelin signaling pathway
    106564260
   04020 Calcium signaling pathway
    106564260
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106564260
  09143 Cell growth and death
   04114 Oocyte meiosis
    106564260
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106564260
   04540 Gap junction
    106564260
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106564260
   04912 GnRH signaling pathway
    106564260
   04914 Progesterone-mediated oocyte maturation
    106564260
   04916 Melanogenesis
    106564260
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106564260
   04270 Vascular smooth muscle contraction
    106564260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106564260
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106564260
   03036 Chromosome and associated proteins [BR:sasa03036]
    106564260
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106564260
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106564260
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106564260
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106564260
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH
Other DBs
NCBI-GeneID: 106564260
NCBI-ProteinID: XP_013985779
UniProt: A0A1S3L5I8
LinkDB
Position
ssa12
AA seq 351 aa
MGNVPTAKKGSEMESVKEFLAKAKEDFLKKWENPAQNTASLEQFERLKTLGTGSFGRVML
VKHKETGQHFAMKILNKQKVVKLKQIEHTLNEKRILTAVSFPFLVQVEFSFKDNTNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKWFAT
TDWIAVYQRKVEAPFVPKFKGPGDTSNFEEYEEEEIRVSISEQCAKEFTDF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgtgcccacggccaagaaggggagcgagatggagagtgtgaaggagttcctg
gctaaagccaaagaggactttctcaagaagtgggagaaccctgcacagaacacagcgagt
ctggagcagtttgagcggttgaaaactctgggtacgggttcgtttggccgcgtcatgctg
gtcaagcacaaagagaccgggcaacactttgccatgaagatcctcaacaagcagaaggtt
gtaaagctgaaacagatagaacatactctgaatgagaagcgtattctaacggctgtcagc
ttccctttcctggtacaagtagagttctccttcaaggacaacactaacctgtacatggtg
atggagtatgtgcctggtggagagatgttctctcatctacgacgaatcggcaggttcagt
gagcctcatgctcggttctacgcggctcagattgtcctcacctttgagtacctgcacgcc
ctggacctcatctaccgagacctgaaaccggagaacctgctcatagaccagcaaggctac
atacaggtgacagattttggttttgctaagcgtgtgaaaggtcgaacctggacgctgtgt
ggaaccccagagtacctggccccagagatcatcctcagcaagggatataacaaggcggta
gactggtgggcgttgggtgtgttggtctatgagatggcagccggttaccctcccttcttc
gctgaccagcccatacaaatttacgagaagatcgtctctgggaaggtgcgtttcccctcc
cacttcagctctgacctgaaggatctgttgaggaatctactacaggtggacctgaccaag
cgctatggcaacctgaagaacggcgtcaacgacatcaagggacacaagtggttcgccacc
actgattggatcgctgtataccagagaaaggtggaggccccgttcgttcctaagttcaaa
ggcccaggtgacaccagcaactttgaggagtacgaagaggaggagatcagagtctccatc
agtgaacaatgtgccaaggagttcactgacttctag

KEGG   Salmo salar (Atlantic salmon): 106569146
Entry
106569146         CDS       T04363                                 

Gene name
KAPCB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106569146 (KAPCB)
   04310 Wnt signaling pathway
    106569146 (KAPCB)
   04340 Hedgehog signaling pathway
    106569146 (KAPCB)
   04371 Apelin signaling pathway
    106569146 (KAPCB)
   04020 Calcium signaling pathway
    106569146 (KAPCB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106569146 (KAPCB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106569146 (KAPCB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106569146 (KAPCB)
   04540 Gap junction
    106569146 (KAPCB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106569146 (KAPCB)
   04912 GnRH signaling pathway
    106569146 (KAPCB)
   04914 Progesterone-mediated oocyte maturation
    106569146 (KAPCB)
   04916 Melanogenesis
    106569146 (KAPCB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106569146 (KAPCB)
   04270 Vascular smooth muscle contraction
    106569146 (KAPCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106569146 (KAPCB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106569146 (KAPCB)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106569146 (KAPCB)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106569146 (KAPCB)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106569146 (KAPCB)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106569146 (KAPCB)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106569146 (KAPCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 106569146
NCBI-ProteinID: XP_013995652
UniProt: A0A1S3LXJ4
LinkDB
Position
ssa14
AA seq 354 aa
MGNTATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSTTGLDDFDRLKTLGTGSFGR
VMLVKHKGTEQFFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLDYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDH
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEEIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacactgctaccgccaagaaaggcaacgagcttgagagcgagacttttgtgaaa
gagtttttagccaaagccaaagaagacttcttacggaaatgggaatgtccaccacagagc
acaacgggcctagatgactttgacaggctaaagaccctgggtacaggctcgttcggaaga
gtcatgctggtcaaacataaaggaacagagcagttcttcgctatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacgctaaacgagaagagaatattgcag
gctgtgtcttttcccttcctcgtcagacttgactatgccttcaaggacaactccaatttg
tacatggtgatggagtacgttccaggaggagagatgttctcacatctaagacgaatcgga
aggttcagtgaaccgcacgcacggttttacgcagcccagatagtactgacgtttgagtac
cttcattcacttgaccttatttacagagatctgaagcctgagaaccttctaatcgatcac
cacggctacatccaggtgaccgactttggattcgccaagagggtaaaaggcagaacctgg
acgttgtgtggaactccagagtacctggcaccagagatcatcctcagcaagggctacaac
aaagcagtggattggtgggccctgggggtccttatatatgagatggctgctggataccct
cccttcttcgctgaccagcccattcagatctatgagaagattgtgtctggaaaggtccgc
ttcccatcccacttcagctctgacctgaaggacctgctgaggaacctgctgcaggtggac
ctgaccaaacgctatggcaacctgaagaacggtgtaaacgacatcaagggacacaagtgg
ttcgcaacaacggactggatcgccatctacgagaggaaggtggaagccccgttcatacca
aagtgtcgaggcgctggagacacaagcaacttcgacgactacgaggaggaggagatccgc
gtctccgtaacggaaaaatgcgcaaaggagttttccgagttttag

KEGG   Salmo salar (Atlantic salmon): 106592286
Entry
106592286         CDS       T04363                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106592286
   04310 Wnt signaling pathway
    106592286
   04340 Hedgehog signaling pathway
    106592286
   04371 Apelin signaling pathway
    106592286
   04020 Calcium signaling pathway
    106592286
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106592286
  09143 Cell growth and death
   04114 Oocyte meiosis
    106592286
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106592286
   04540 Gap junction
    106592286
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106592286
   04912 GnRH signaling pathway
    106592286
   04914 Progesterone-mediated oocyte maturation
    106592286
   04916 Melanogenesis
    106592286
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106592286
   04270 Vascular smooth muscle contraction
    106592286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106592286
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106592286
   03036 Chromosome and associated proteins [BR:sasa03036]
    106592286
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106592286
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106592286
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106592286
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106592286
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH
Other DBs
NCBI-GeneID: 106592286
NCBI-ProteinID: XP_014039086
UniProt: A0A1S3QGI5
LinkDB
Position
ssa02
AA seq 210 aa
SLWPSPQNTASLEQFERLKTLGTGSFGRVMLVKHKETGQHFAMKILNKQKDNTNLYMVME
YVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHALDLIYRDLKPENLLIDQQGYIQ
VTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFAD
QPIQIYEKIVSGKVSWASVTDISTCRKISP
NT seq 633 nt   +upstreamnt  +downstreamnt
tctctgtggccctctcctcagaacacagcgagtctggagcagtttgagcggttgaaaact
ctgggtacgggttcgtttggccgcgtcatgctggtcaagcacaaagagaccgggcaacac
tttgccatgaagatcctcaacaagcagaaggacaacactaacctgtacatggtgatggag
tatgtacctggtggagagatgttctctcatctacgacgaatcggcaggttcagtgagcct
catgctcggttctacgcggctcagattgtcctcacctttgagtacctgcacgccctggac
ctcatctaccgagacctgaaaccggagaacctgctcatagaccagcagggctacatacag
gtgacagattttggttttgctaagcgtgtgaaaggtcgaacctggacactgtgtggaacc
ccagagtacctggccccagagatcatcctcagcaaggggtataacaaggcggtagactgg
tgggcgttgggtgtgttggtctatgagatggcagccggttaccctcccttcttcgctgac
cagcccatacaaatttacgagaagatcgtctctgggaaggtgagctgggctagtgtaacg
gacataagtacgtgccgtaagatctctccatag

KEGG   Salmo salar (Atlantic salmon): 106599750
Entry
106599750         CDS       T04363                                 

Gene name
KAPCB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta-like
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106599750 (KAPCB)
   04310 Wnt signaling pathway
    106599750 (KAPCB)
   04340 Hedgehog signaling pathway
    106599750 (KAPCB)
   04371 Apelin signaling pathway
    106599750 (KAPCB)
   04020 Calcium signaling pathway
    106599750 (KAPCB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106599750 (KAPCB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106599750 (KAPCB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106599750 (KAPCB)
   04540 Gap junction
    106599750 (KAPCB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106599750 (KAPCB)
   04912 GnRH signaling pathway
    106599750 (KAPCB)
   04914 Progesterone-mediated oocyte maturation
    106599750 (KAPCB)
   04916 Melanogenesis
    106599750 (KAPCB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106599750 (KAPCB)
   04270 Vascular smooth muscle contraction
    106599750 (KAPCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106599750 (KAPCB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106599750 (KAPCB)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106599750 (KAPCB)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106599750 (KAPCB)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106599750 (KAPCB)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106599750 (KAPCB)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106599750 (KAPCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 106599750
NCBI-ProteinID: XP_014046524
UniProt: A0A1S3R462
LinkDB
Position
ssa03
AA seq 354 aa
MGNAATAKKGNELESETFVKEFLAKAKEDFLRKWECPPQSTTGLDDFDRLKTLGTGSFGR
VMLVKHKGTEQFFAMKILDKQKVVKLKQIEHTLNEKRILQAVSFPFLVRLDYAFKDNSNL
YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQ
HGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYP
PFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKGHKW
FATTDWIAIYERKVEAPFIPKCRGAGDTSNFDDYEEEEIRVSVTEKCAKEFSEF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggaaacgctgctaccgccaagaaaggcaacgagctggagagcgagacttttgtgaaa
gagttcctagccaaagccaaagaagacttcttacggaaatgggaatgtccaccacagagc
acgacgggcctagatgactttgacaggctaaagaccctcggtacaggctcgtttggaaga
gtcatgctggtcaaacataaaggaacagagcagttcttcgccatgaaaatactggacaag
caaaaggtggtgaaactcaagcaaatagaacacacgctaaatgagaagagaatattgcag
gccgtgtcatttcccttcctcgtcagacttgattatgccttcaaggacaactccaatttg
tacatggtgatggagtatgttccaggaggagagatgttctcacatctaagacgaatcgga
aggttcagtgaaccgcacgcacggttttacgcggcccagatagtactgacgtttgagtac
ctccattcactagaccttatctacagagatctgaagcctgagaaccttctaatcgatcag
catggctacatccaggtgacagactttggatttgccaagagggtaaaaggcagaacctgg
acgttgtgtggaactccagagtacctggcgcccgagatcatcctcagcaagggctacaac
aaagcagtggactggtgggccctgggggtccttatatatgagatggctgctggataccct
cccttctttgctgaccagcctattcagatctatgagaagattgtgtctggaaaggtccgc
ttcccatcccactttagctctgacctgaaggacctgctgaggaacctgctgcaggtggac
ctgaccaaacgctacggcaacctgaagaacggcgtcaacgacatcaaaggacacaagtgg
ttcgctacaacggactggattgccatctacgagaggaaggtggaagccccgttcatacca
aagtgtcgaggcgctggagacacgagcaacttcgacgactacgaggaggaggagatccgc
gtttccgtaacggaaaaatgcgcaaaggagttttccgagttttag

KEGG   Salmo salar (Atlantic salmon): 106606839
Entry
106606839         CDS       T04363                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106606839
   04310 Wnt signaling pathway
    106606839
   04340 Hedgehog signaling pathway
    106606839
   04371 Apelin signaling pathway
    106606839
   04020 Calcium signaling pathway
    106606839
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106606839
  09143 Cell growth and death
   04114 Oocyte meiosis
    106606839
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106606839
   04540 Gap junction
    106606839
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106606839
   04912 GnRH signaling pathway
    106606839
   04914 Progesterone-mediated oocyte maturation
    106606839
   04916 Melanogenesis
    106606839
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106606839
   04270 Vascular smooth muscle contraction
    106606839
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106606839
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106606839
   03036 Chromosome and associated proteins [BR:sasa03036]
    106606839
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106606839
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106606839
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106606839
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106606839
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 106606839
NCBI-ProteinID: XP_014058693
UniProt: A0A1S3S2U2
LinkDB
Position
ssa06
AA seq 381 aa
MSGSDSHRKSSRRHGSRKRESGPTSGSGAAEAAVAAPEMPIMIPDVKEFLAKAKEDFLKK
WENPAQNTAALDGFDRLKTLGTGSFGRVMLVKHKESGQHFAMKILDKQKVVKLKQIEHTL
NEKRILQAVSFPFLVRLEHSFKDNTNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQ
IVLTFEYLHSLDLIYRDLKPENLLIDNQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLL
RNLLQVDLTKRFGNLRNGVNDIKGHKWFATTDWIAIYQRKVEAPFIPKCKGPGDTSNFDD
YEEEEIRVSFTEKCGKEFAEF
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtcaggctcagacagccacaggaagagctccaggaggcatggtagcaggaagagggag
tctgggcccacctctggctccggggctgcagaggctgcggttgcagcaccagagatgccc
ataatgatccctgacgtgaaggagtttcttgccaaagccaaagaggatttcctcaagaaa
tgggagaatccagcacagaacactgcggccttggatggctttgaccgtctgaagaccctg
ggcacgggctcgtttggtcgagtcatgctggtcaagcacaaagagtcgggccagcatttt
gccatgaagatacttgacaaacagaaggtggtgaagctgaagcagatagaacacacgctg
aatgagaaacgcatcctgcaggccgtcagcttccccttcctggtgcggttggagcactct
ttcaaggacaacactaacctgtatatggtgatggagtatgtccctggtggtgagatgttc
tcacatttaaggagaattggcaggttcagtgagccccacgcccgcttctacgccgcccaa
attgttctgacctttgaataccttcactcactggacctcatctaccgagacctgaaacca
gagaacctgctcattgacaaccagggatacatacaggtaacagattttggttttgcaaag
cgagtgaagggccggacttggacgctgtgtggcactccggagtacctggcccccgaaatc
atccttagcaaaggttataataaggcagtggactggtgggctctgggcgtgctgatttat
gagatggctgctggctatcctcccttctttgctgaccagcccattcagatctatgagaag
attgtatcagggaaggtgcgctttccctcccacttcagctcggacctgaaggacctgctg
aggaacctgctccaggtggacctgaccaagcgcttcggaaacctgcgcaacggagtcaac
gacatcaagggccacaagtggttcgccaccactgactggattgccatttaccagaggaag
gtggaggcaccgtttattcccaagtgcaaaggccccggtgacaccagcaactttgacgac
tatgaggaagaggaaatccgagtctccttcacagagaaatgtggcaaggagtttgccgag
ttctag

KEGG   Salmo salar (Atlantic salmon): 106613442
Entry
106613442         CDS       T04363                                 

Gene name
prkacb, KAPCB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04530  Tight junction
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613442 (prkacb)
   04310 Wnt signaling pathway
    106613442 (prkacb)
   04340 Hedgehog signaling pathway
    106613442 (prkacb)
   04371 Apelin signaling pathway
    106613442 (prkacb)
   04020 Calcium signaling pathway
    106613442 (prkacb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613442 (prkacb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106613442 (prkacb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106613442 (prkacb)
   04540 Gap junction
    106613442 (prkacb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613442 (prkacb)
   04912 GnRH signaling pathway
    106613442 (prkacb)
   04914 Progesterone-mediated oocyte maturation
    106613442 (prkacb)
   04916 Melanogenesis
    106613442 (prkacb)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106613442 (prkacb)
   04270 Vascular smooth muscle contraction
    106613442 (prkacb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106613442 (prkacb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106613442 (prkacb)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106613442 (prkacb)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106613442 (prkacb)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  PKA family
   106613442 (prkacb)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106613442 (prkacb)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106613442 (prkacb)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 106613442
NCBI-ProteinID: XP_014071118
UniProt: A0A1S3T3E7
LinkDB
Position
ssa10
AA seq 389 aa
MAQGKDHSFLKLDDLASRFFNRYRKGNQEQKAQESEGPHVSEFTIIWDKLKTFVKEFLAK
AKEDFLRKWECPPQSTTGLDDFDRLKTLGTGSFGRVMLVKHKGTEQFYAMKILDKQKVVK
LKQIEHTLNEKRILQAVSFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEH
HARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGT
PEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHF
SSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYERKVEAPFIPKCRGP
GDTSNFDDYEEEDVRVSDTEKCAKEFSEF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcccagggaaaggatcattccttcctaaagctggacgaccttgccagccgattcttc
aacaggtatcgcaaaggcaaccaagagcaaaaagcccaggagagtgaggggcctcatgtc
tcagagttcaccatcatttgggataaattgaagacttttgtgaaagagttcttagccaaa
gccaaagaagattttttacgaaaatgggagtgcccaccacagagcacaactggactggat
gactttgacaggctgaagactctgggcacaggctcgttcggtagagttatgttggtgaaa
cataaaggaacagaacagttctacgcaatgaagatcctggacaaacagaaagtggtgaag
ctgaagcagatagaacacacgctaaacgaaaagagaatactgcaggcggtgtccttcccc
tttctcgtgagactagagtattccttcaaggataactccaacctctacatggtgatggag
tacgttccaggaggagaaatgttctcgcatttgagacgcatcgggaggttcagtgaacat
cacgcacgattttatgcagctcagatagtactcacttttgagtacctccactcgctagac
cttatctacagagacctgaagcctgaaaaccttctcattgatcaccaagggtacatccag
gtcacagactttggctttgccaaaagagtcaaaggcaggacctggacattgtgtggaact
ccagagtacctggctccagagatcatcctcagcaagggctacaacaaagctgtggactgg
tgggcactgggagtcctgatctacgagatggccgctgggtaccccccattcttcgctgat
cagccaatccagatctacgagaagatcgtgtctggcaaggtacgattcccctcccacttc
agctcagacttgaaagacctgctgaggaacctgctccaggtggacctgacgaagcgctac
ggcaacctgaagaatggggtgaatgacatcaagaaccacaagtggttcgccacaacagac
tggatcgcaatctacgagaggaaggtggaagctcccttcataccaaagtgcagaggacca
ggagacacaagcaactttgacgactacgaagaggaggatgtccgtgtgtccgacacagaa
aagtgtgcgaaggagttttccgaattctag

DBGET integrated database retrieval system