KEGG   Salmo salar (Atlantic salmon): 106564303
Entry
106564303         CDS       T04363                                 

Definition
(RefSeq) tuberin-like
  KO
K07207  tuberous sclerosis 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04218  Cellular senescence
sasa04910  Insulin signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    106564303
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106564303
  09143 Cell growth and death
   04115 p53 signaling pathway
    106564303
   04218 Cellular senescence
    106564303
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106564303
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106564303
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106564303
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106564303
SSDB
Motif
Pfam: Tuberin DUF3384
Other DBs
NCBI-GeneID: 106564303
NCBI-ProteinID: XP_013985815
UniProt: A0A1S3L4V4
LinkDB
Position
ssa12
AA seq 1009 aa
MNKQPSKESLKDKVKGIFGLGSPRPPSKQTDSKPSEFIITLDILKELHPDCGLSNRIRVA
NHVCDLAKAKKFEEHAVEAVWKAVEDMLTPEQPPEARHAVLLLLRAIIQGQGERLGPLRA
FFFKVIRDYQPSNEDLSDRLEVFKALTENGKDITYLEEDIAGFVLLWMDIGLTADFLHVL
VNLVKFNSCYLDQNISVMVQKICLLCNRTTASTDIEVSLQVLDAVVCYNCLPSDSLTVFI
ITLCRTVNVKEFCESCWKLMRKVLGTHLGHSAIYTMCRIMEERAYMEDSLLLRGAVFFVG
MALWGAHRLPALKNTPTLVLPSFYKAMWCANEMVSYEIVLSITRLIKKYGKELQVVTWDI
LLGIIERLLQQIQSIGSAELKSIVYELLTTVEELYEQNGFHGSSDKFFSLVEKCADKRPD
ASVLTLISYRAQSIQPAKDGWIQSLHRLMEKFFRNESRSVIRIKVLHILSFVLSTNRQLY
EEELIEVVVVPQLSGIAEDRDLAVRRQATQLLVDLAESCTTHHFTSLLDIIQRVASRSLV
CPGPLEVSERDPTAESSMEDVRTAIRGLLEILQSKLYSLPASHASRVYELLIGHLQLHYK
NKYSSAVACSIRLQVFDFLLMMRTDSLHRLGFLSKDGVLRFSPYCHCDMGEPEKRGSEKK
PAGSVSPPAGSPAPSSTTTPSSSSIRTACLPYSPAFNVLLQCLKMETDWKVLKLVLEKMS
WTLQYKVLLLSSPCSIDQLCSTLCSMVTDRLISERLKKTPDGFSRTDVQLAVVPVLTAIT
SYHNYLEQARQRELVQCLEAGLIYRCAKQCVVALTMCTVEMPDIMVKLLPALIVKLTHIS
ATVAMASPMLEFLSTLVRLPHLYAYFVAEQYVSVFAISLPYTNPSKFNQYIVSLAHHVIS
MWFIRCRLTFRKDFVQYITKGLRSNALMPFDDTQDTQSSFRARSTSLNERPKSLRAAKMA
KAHLQQQQASMAAGVAASTGSPVKELRDLSAMDAFRSRSISVSEHAVRR
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgaacaagcagcccagtaaagagagtctgaaggacaaggtcaaggggatatttggtttg
ggatcccctcgaccccccagcaagcagacagacagcaagccctcagagttcatcatcacg
ctagatatacttaaggagctgcaccctgactgtggccttagcaacagaatccgggttgct
aaccatgtctgtgacctggccaaggccaagaagtttgaggagcatgcagtggaagcagta
tggaaggcggtggaggatatgctgactccagaacagccacctgaagctagacatgctgtc
ctgctgctcctcagagctatcatacagggacagggtgagcgtctgggtcctctgcgggcc
ttcttcttcaaggtgatcagagactaccagccgtccaatgaggacctgtctgacaggctg
gaggtgttcaaggccctgacggagaacgggaaggacatcacttacctggaggaggacata
gctgggtttgtcctgctgtggatggacattggtctgaccgctgacttcctccacgtcctg
gtcaacctggtcaagttcaacagctgctacctcgaccagaacatatctgtcatggtccag
aagatctgtctgctgtgtaacaggacaacagcttctacagacatagaggtgtctctacag
gtgcttgatgcggtggtgtgttataactgcctcccctctgactccctcaccgtcttcatc
atcactctctgtcgcaccgtcaacgtcaaggagttctgtgagtcctgctggaagttgatg
aggaaggtgttggggactcatctgggccatagtgccatatacaccatgtgccgtatcatg
gaggagagggcgtatatggaggattctctgctgctgagaggagcagtgttcttcgtaggg
atggctctatggggagcgcaccgtctcccagccttaaagaacacccctaccctggtcctc
ccatcattctataaggcgatgtggtgtgccaacgagatggtgtcgtatgagatcgttctg
tccatcaccagactgataaagaagtatggcaaggagctccaggtggtcacatgggacata
ctgctggggatcatagagaggttactacagcagattcagtcgataggcagtgcagagctg
aagtccatagtgtatgagttgctgactacagtggaggagctctatgagcagaacggcttc
catggatcatctgacaagttcttcagtctggtggagaagtgtgctgacaaaagacctgat
gcgtcggtgctgactctgatatcgtaccgggcccagtccatccagccagctaaagacggg
tggatccagagtctacaccgcctcatggagaagttcttcaggaatgagagtcgtagtgtg
atcaggatcaaagtgcttcacatcctctcctttgtcctcagcaccaaccgccagctctac
gaggaggagctgatagaggtggtggtggttcctcagctcagtgggatagcagaggacaga
gacctggctgtgaggagacaggctacccagctactggtggatctggctgagagctgtact
acacaccacttcaccagcctcctggacatcatccagagggtggcgagtcgttcgctggtg
tgcccagggcccctggaggtgtcggagagagaccccacggcagaatcctccatggaggac
gtcaggactgctatacgaggcctactggagatactgcagagtaagctgtacagcctgcca
gccagccacgctagtcgagtgtacgagctgctgatcggacacctgcagctgcactacaag
aacaagtacagctccgctgtggcctgcagcatacgactacaggtgtttgacttcctcctg
atgatgagaacagactccctccatcgtctggggttcctcagtaaagacggggtgctgagg
ttcagtccgtactgccactgtgacatgggggagccagagaaacgagggagtgagaagaag
cctgcaggctcagtgtctccccctgctggcagtcctgccccctcctccaccactactccc
tcctcctcctccatccgtacagcctgcctgccctactcacctgcctttaatgtgctgcta
cagtgcctgaagatggagacagattggaaggtgttgaagctggtactagagaagatgtcc
tggaccctgcagtataaagtcctgctgctgtcctctccctgcagcatagaccagctctgt
tctacactctgttctatggtgacagaccgtcttatctcagagcgtctgaagaagactcca
gatggtttcagtcgtactgatgtccagctggctgtagtacctgttctcactgctatcaca
tcataccacaactacctagaacaggccagacagagggagttggttcagtgtctggaggca
gggctgatataccgctgtgctaagcagtgtgtggttgccctgacaatgtgcaccgtggag
atgcctgacatcatggttaaactcctccccgccctcatcgtcaagctgacgcacatctcg
gcaaccgtcgccatggcgtcgcccatgctggaattcctgtccactctggtgcggctgcca
catctctatgcttactttgtagcagagcagtacgtcagtgtgttcgccatctccctgccc
tacaccaacccctccaagtttaaccagtacattgtgtcgttggctcaccatgtcatctcc
atgtggtttatccgctgcagactcaccttcagaaaggattttgtgcagtacatcaccaag
ggtctgcgctctaatgctctgatgccgtttgatgacacccaggacactcagagcagcttc
cgtgctcgcagcaccagcctcaatgagaggcccaagagtctacgggcagccaaaatggcg
aaggcccacctccagcagcagcaggcgtcaatggcagcaggcgtagcggcgagtaccggc
tctcccgttaaagagctgagagatctgtcggccatggacgccttccgctcccgaagcatc
agcgtctccgagcacgcggtgcgcaggtag

DBGET integrated database retrieval system