KEGG   Salmo salar (Atlantic salmon): 106564790
Entry
106564790         CDS       T04363                                 

Definition
(RefSeq) son of sevenless homolog 1-like
  KO
K03099  son of sevenless
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564790
   04012 ErbB signaling pathway
    106564790
   04068 FoxO signaling pathway
    106564790
   04150 mTOR signaling pathway
    106564790
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106564790
   04540 Gap junction
    106564790
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106564790
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106564790
   04912 GnRH signaling pathway
    106564790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106564790
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   106564790
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Herpes_UL92 PH_10 IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 106564790
NCBI-ProteinID: XP_013986641
UniProt: A0A1S3L6P4
LinkDB
Position
ssa12
AA seq 1385 aa
MQAAQVQYDFFSEENAPKWRGLLVPSLNKVLSQVHPKLSSQEDALQYIEELILLLLSMLC
QAQPRSVQDVEERVQKSFPHPIDKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMFHQDE
EDISGFPLMDEEPSTSEEQTYYDLVKTFMAEVRQYLRDLNLIIKVFREPIASNAVYFSHH
DVENIFSRIVDIHEVTLKLLGLIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYETYAQ
DILRTGFHDHFLSQLSKPGAASYLQSICEGFKEAVQYVLPRLLLTPVYHCLHYFEILKQL
EEKSEDEEDKECLKQAITALLNLQSSMERICSKNMAKRRLSESACRFYSQQMKGKHLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASSTAEYRLKEKFFMRKVQINDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEDKNGWM
AALISLQYRSTLERMLDSAMLQEEKEEQMRLPGAELYRFATPDSEENVVFEENVQSKSGI
PIIKAGTVLKLIERLTFHMYADPNFVRTFLTTYRSFCKPQELLGLLMERFEIPEPKPTEA
DQMAIENGDQPLSAELKRFRKEFVQPVQLRVLNVCRHWVEHHFYDFERDCQLLKRLEEFI
ALVRGKAMKKWVESITKIIQRKKQAQANGPSHNITFESSPPPIEWHLSKPGQTDQFDLMT
LHPIEIARQLTLLESDFYRAVQPSELVGSVWTKEDKELNSPNLLRMIRHTTNLTLWFEKC
IVETENLEERAAVVARIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQR
KILEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINF
SKRRKVAEITGEIQQYQNQPYCLRVENDIRKFFENLNPMEDKAEKEFADYLFNKSLEIEP
RNARSLPRFVGRRPSALYGRNAPAIIKPKKYNCPLKSPGVRPSSVRQGTMRHPTPLQNEP
RKISYSRIPDSEMESAASAPNSPRTPLTPPPASATSSTTDIGSVFDSPQGPSSPFHSNCD
SIFAPVSLPHGPRSSSVSSMVSLHRSTEDATVPPPVPPRRRPESAPAESSPSKMMSKHLD
SPPAIPPRQPTTTKVYSPRYSLSTERTSVSEPPDSPPTLPPREPVRTPDVFSSSNSPLHL
QPPPQGRIRSSEPTLSQTFFPPSPFGPLTPPPPPTPSPSLGPRKHLPSPPLPLLGPGGPD
CCGDSALLPPGGAAGPPVPPRQSTSSAAVQAIPKLPPKTYKRESVSYPSLVHRDGPPLLE
NANPF
NT seq 4158 nt   +upstreamnt  +downstreamnt
atgcaagcggcccaggttcagtacgactttttcagcgaggagaacgcaccgaaatggcgg
gggctattggtaccctccctgaacaaggtgctgagccaggtacatcccaaactgtcgtcc
caggaggatgcgctgcagtacatcgaggagctgatcctgctgctgctcagcatgctctgc
caggcacagccacgcagcgtgcaggacgtggaggagcgagtgcagaagagtttccctcac
cctatcgataagtgggctatcgccgacgcccaggcggccatcgaaaagaggaagaggagg
aatcctttggccctgccggtggataagatccacccgctgctcaaggaggtactagggtac
aagattgaccaccaggtgtcggtgtacatcgtggccgtgttggagtacatctcagcagac
atcctgaagctggcagggaactacgtgaggaacatccgccactacgagatctcccagcag
gacatcaccgtggccatgtgtgccgataaggttctgatggacatgttccaccaggatgag
gaggacatcagcggtttccccctgatggacgaggagccgtccaccagcgaggagcagacc
tactacgacctggtcaagaccttcatggctgaggtccgacagtacctgcgcgacctcaac
ctcatcatcaaggtgttccgcgagccaatcgcctccaacgctgtgtacttctcccaccat
gatgtggagaacatcttcagccgcatcgtggacatccacgaggtcaccctcaagttgctg
ggcctcattgaagacacggtggagatgacagacgaggggagcccacacccgctggtgggc
agctgctttgaagacctggccgaggagctggccttcgacccctatgagacgtatgctcaa
gacattctgcggactggcttccacgatcacttcctcagccagctgtctaaaccgggagct
gcctcctacctccagtctatatgcgaaggctttaaggaagcagtccagtacgtcctgccc
cggttactcctgacacctgtctatcattgtctccactattttgagatcttaaagcaactg
gaggagaaaagtgaggacgaggaggacaaggagtgtctgaagcaggccatcacggcgctg
ctcaatctgcagagtagcatggagaggatctgctccaagaacatggccaagaggaggctg
agcgagtcggcctgccgcttctacagccagcagatgaagggcaagcacctggccatcaag
aagatgaacgagatccagaagaacattgatggctgggagggcaaggacatcggccagtgc
tgcaacgagttcatcatggaggggacgctgacacgcgtgggcgccaaacacgaacggcac
atcttcctcttcgacggcctgatgatttgctgcaagtccaaccacggccagccgcgcttg
cctggcgcctcgtccaccgccgagtaccgcctcaaggagaagttcttcatgcgcaaggtg
cagatcaacgacaaggacgacaaggagggcgagtaccggcacgcctttgagatcatcctc
aaagacggcaacagcgtggtgttcgctgccaagtcggccgaggacaagaacggctggatg
gcggcgctcatctcgctgcagtaccgctcgacgctggagcgcatgctggactcggccatg
ctgcaggaggagaaggaggagcaaatgaggctgcccggggcggagctttaccggttcgcc
acacccgactctgaggagaacgtggtgttcgaggagaacgtgcagtccaagtcgggcatc
cctatcatcaaggcggggacagtgctcaagctcattgaaaggctcaccttccacatgtat
gcagatccaaattttgtccgaacatttctaacaacctacaggtccttctgcaaacctcag
gagctgctgggtcttcttatggagaggtttgaaatccccgagccaaagcccacagaggca
gaccagatggccatagagaacggagaccaacctctcagcgccgaactcaaacgatttcgc
aaggagtttgtccagccagtccaactccgagtactgaatgtatgtcgccactgggtggag
caccacttctatgactttgagcgggactgccagttactcaagcgtctggaggagttcatt
gcattggtgcgaggcaaggccatgaagaagtgggtggagtccatcaccaagatcatccag
aggaagaagcaggctcaggccaacgggcccagccacaacatcacattcgagagctcgcca
ccgcccatcgagtggcacctcagtaagccaggccagacagaccagtttgacctcatgacc
ctccaccccattgagatcgcccggcagctcacactgctcgagtccgacttctacagggcg
gtgcagccgtcagagctggtgggaagcgtgtggacaaaggaggacaaggagctgaactcg
cccaaccttctgcgcatgatccgccacaccaccaacctcacgttgtggttcgaaaagtgt
atcgtagagacggagaacctggaagagcgggcagcggtggtggcgcgtatcatcgagatc
ctgcaggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatg
aactcctcgcccgtctaccggctagaccacacctttgagcaaattccaagccgacagcgg
aagattctggaggaggcccacgaactgagcgaggaccactacaagaagtacttggcaaaa
ctacgctccatcaaccccccctgtgtccccttctttgggatctatttgacgaacatcctg
aagacggaggaaggcaaccctgacttcctgaagaggcatggcaaggagctgatcaacttc
agcaagcgacggaaagtggccgagatcaccggggagatccagcagtaccagaaccagcct
tactgcttacgggtggagaacgatatccggaagttctttgaaaacctcaatccaatggag
gacaaggcagagaaggagtttgctgactatctgttcaacaagtcactggagatcgagcct
cggaatgcccggtcattgcctcgatttgtggggcggcgtccgagcgccctctatggacgc
aacgcccctgctattattaagcccaagaagtacaactgcccgctcaagtcccccggcgtg
cgcccgtcctcggtgcgccagggcaccatgcgccacccgacgccactgcagaacgagccg
cgcaagatcagctacagccgcatccctgacagcgagatggagagcgccgcctctgcgccc
aactcgccgcgcacgcccctcacgccgccaccagcctcggccacctccagcaccacagac
atcggcagcgtgttcgactcgccccagggcccctccagccccttccactccaactgcgac
agcatctttgccccggtctctttaccacacggcccacggtcctcctcggtttcctccatg
gtgagtctccacaggagcactgaagacgccaccgtccccccacctgtgccccctcgcaga
cgccccgaatccgcccccgctgaatcttccccttcgaagatgatgtccaagcacttggac
agcccccccgccatccccccgcggcagcccaccaccaccaaggtctactcgccgcgctac
tcgctctcaaccgagcgcacctccgtgtcggagccgcctgacagcccacccaccctgcca
ccgagggagcctgtgagaacgccggacgtcttctccagctccaacagccccctgcacctg
cagccacccccacagggccgcatccgcagcagcgaacccacgctgagccagaccttcttc
cccccctcgccgttcggcccgctcaccccgccaccacccccgactccatcgccctcgctg
gggccgcgcaagcacctgccctccccgcccttaccactgctggggcccggcggcccagac
tgctgcggcgactcagccctcctccctccggggggtgcagctggcccccctgtgcccccc
cgccagagcaccagcagcgctgctgtccaagccatccccaagctcccccccaaaacgtac
aaaagggagtcggtgtcatacccatccctagtgcatcgagacggcccgcccctgctggag
aatgccaaccccttttaa

KEGG   Salmo salar (Atlantic salmon): 106584773
Entry
106584773         CDS       T04363                                 

Definition
(RefSeq) son of sevenless homolog 1-like
  KO
K03099  son of sevenless
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584773
   04012 ErbB signaling pathway
    106584773
   04068 FoxO signaling pathway
    106584773
   04150 mTOR signaling pathway
    106584773
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584773
   04540 Gap junction
    106584773
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584773
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106584773
   04912 GnRH signaling pathway
    106584773
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106584773
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   106584773
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH Herpes_UL92 PH_10 IQ_SEC7_PH PH_19
Other DBs
NCBI-GeneID: 106584773
NCBI-ProteinID: XP_014025804
UniProt: A0A1S3PEE7
LinkDB
Position
ssa02
AA seq 1363 aa
MHMSVSVKVLSQVHPKLSSQEDALQYIEELILLLLNMLCQAQPRSVQDVEERVQKSFPHP
IDKWAIADAQAAIEKRKRRNPLALPVDKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADI
LKLAGNYVRNIRHYEISQQDITVAMCADKVLMDMFHQDEEDISGFPLMDEEPSTNEEQTY
YDLVKTFMAEVRQYLRDLNLIIKVFREPFTSDAMLFSHHDVENIFSRIVDIHEVTLKLLG
LIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYETYAQDILRTGFHDHFLNQLSKPKAA
FYLQSICEGFKEAVQYVLPRLLLTPVYHCLHYFEILKQLEEKSEDEEDKECLKQAITALL
NLQSSMERICSKNMAKRRLSESACRFYSQQMKGKHLAIKKMNEIQKNIDGWEGKDIGQCC
NEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASSTAEYRLKEKFLMRKVQ
INDKDDKEGEYRHAFEIILKDGNSVVFAAKSAEDKNGWMAALISLQYRSTLERMLDSAML
QEEKEEQMRLPGAELYRFATPDSEENVVFEENVQSKSGIPIIKAGTVLKLIERLTFHMYA
DPNFVRTFLTTYRSFCKPQELLGLLMERFEIPEPKPTEADQMAIENGDQPLSAELKRFRK
EFVQPVQLRVLNVCRHWVEHHFYDFERDCQLLKCLEEFIALVRGKAMKKWVESITKIIQR
KKQAQANGPSHNITFESSPPPIEWHLSKSGQTDQFDLMTLHPIEIARQLTLLESDFYRAV
QPSELVGSVWTKEDKELNSPNLLRMIRHTTNLTLWFEKCIVETENLEERAAVVARIIEIL
QVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQRKILEEAHELSEDHYKKYLAKL
RSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINFSKRRKVAEITGEIQQYQNQPY
CLRVESDIRKFFENLNPMEDKAEKEFADYLFNKSLEIEPRNARSLPRFVGRRPSALYGRN
APAIKPKKYNCPLKSPGVRPSSVRPGTMRHPTPLQNEPRKISYSRIPDSEMESAASAPNS
PRTPLTPPPASAASSSTDIGSVFDSPQGPSSPFHSNCDSVFVQVSLPHGPRSSSVSSMVS
LHRNTEDTTVPPPVPPRRRPESAPAESSPSKMMSKHLDSPPAIPPRQPTTTKVYSPRYSL
STERTSVSEPPDSPPTLPPREPMRTPDVFSSSNSPLHLQPPPLGRIRSSEPTLSQTFFPP
SPFGPLTPPPPPTPSPSLGPRKHLPSPPLPLLGPSGPDCCGDSALLPLGGAAGPPVPPRQ
STSSAAAQAIPKLPPKTYKRESVSHPSLVHRDDPPVLENANPS
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcacatgtctgtctccgtgaaggtgctgagccaggtgcaccccaagctgtcgtcccag
gaggatgcgctgcagtacatcgaggagctgatcctgctgctgctcaacatgctctgccag
gcacagccacgcagcgtgcaggacgtggaggagcgagtgcagaagagtttcccgcaccct
atcgataaatgggctatcgctgatgcccaggcggccattgaaaagaggaagaggaggaat
cctttggccctgcccgtggataagatccacccgctgctcaaggaggtactagggtacaag
attgaccaccaggtgtcggtgtacattgtggcggtgttggagtacatctcagcagacatc
ctgaagctggcagggaactacgtgaggaacatccgccactacgagatctcccagcaggac
atcaccgtggccatgtgtgccgataaggttctgatggacatgttccaccaggacgaggag
gacatcagcggtttccccctgatggacgaggagccatccaccaatgaggagcagacctac
tacgacctggtcaagaccttcatggccgaggtccgacagtaccttcgtgacctcaacctc
atcatcaaggtgttccgcgagcccttcacctccgacgccatgctcttctcccaccatgac
gtggagaacatcttcagccgcatcgtggacatccacgaggtcacccttaagctgctgggc
ctcattgaagacacggtggagatgacagatgaggggagcccacacccgctggtgggcagc
tgctttgaagacctggctgaggagctggccttcgacccctacgagacatatgctcaagac
atcctgcggactggcttccacgatcacttcctcaaccagttgtctaaaccgaaagctgcc
ttctacctccagtctatatgcgaaggctttaaggaagcagtccagtacgtcctgccccgg
ttgctcctcacacccgtctatcattgtctccactatttcgagatcttaaagcaactagag
gagaaaagtgaggatgaggaggacaaggagtgtctgaagcaggccatcacggcgctgctc
aatctgcagagtagcatggagaggatctgctccaagaacatggccaagaggaggctgagc
gagtcggcctgccgcttctacagccagcagatgaagggcaagcacctggccatcaagaag
atgaacgagatccagaagaacattgatggctgggagggcaaggacatcggccaatgctgc
aacgaattcatcatggaggggacgctgacacgcgtgggcgccaagcacgaacggcacatc
ttcctcttcgatggcctgatgatctgctgcaagtccaaccacggccagccgcgcttgcct
ggcgcctcgtccactgccgagtaccgcctcaaggagaagttcttaatgcgcaaggttcag
atcaatgacaaggatgacaaggagggcgagtaccggcacgcctttgagatcatcctcaaa
gacggcaacagcgtggtgttcgccgccaagtcggccgaggacaagaatggctggatggcg
gcgctcatctcactgcagtaccgctcgacgctggagcgcatgctggactcggccatgcta
caggaggagaaggaggagcaaatgaggctgcccggggcggagctttaccggttcgccacg
cccgactctgaggagaatgtggtgttcgaggagaatgtgcagtccaagtcgggcatcccc
atcatcaaggcggggacagtgctcaagctcatcgaaaggctcaccttccacatgtatgca
gatccaaatttcgtccgaacatttcttacaacctacaggtccttctgtaaacctcaggag
ctgctgggtcttcttatggagaggtttgaaattcctgagccaaagcccactgaggcggac
cagatggccatagagaacggagaccaacctctcagcgccgaactcaaacgttttcgcaag
gagtttgtccagccagtccaactcagggtactgaatgtatgtcgccactgggtggagcac
cacttctatgactttgagcgggactgtcagttactcaagtgtctggaggagttcattgca
ttggtgcgaggcaaggccatgaagaagtgggtggagtccatcaccaagatcatccagagg
aagaagcaggcacaggccaatgggcccagccacaacatcaccttcgagagctcgccaccg
cccatcgagtggcacctcagcaagtcgggccagacagaccagtttgacctcatgaccctc
caccccattgagatcgcccggcagctcacactgctcgagtccgacttctacagggcggtg
cagccgtcagagctggtgggcagcgtgtggacgaaggaggacaaggagctgaactcgccc
aaccttctgcgcatgatccgccacaccaccaacctcacgttgtggttcgaaaagtgtatc
gtagagacggagaacctggaagagcgggcagcggtggtggcgcgtatcatcgagatcctg
caggtgttccaggagctcaacaacttcaacggcgtgctggaggtggtcagcgccatgaac
tcctcgcccgtctaccggctagaccacaccttcgagcaaattccaagccgacagaggaag
attctagaggaggcccatgaactgagcgaggaccactacaagaagtacctggcaaaacta
cgctccatcaaccccccctgtgtccccttctttgggatctacttgacgaacatcctgaag
acggaggaaggcaaccctgacttcctgaagaggcatggcaaggagctgatcaacttcagc
aagcgacggaaagtggcggagattaccggggagatccagcagtaccagaaccagccctac
tgcttgcgggtggagagcgatatccggaagttttttgaaaacctcaatccaatggaggac
aaggcagagaaggagtttgctgactatctgttcaacaagtcactggagattgagcctcgg
aatgcccggtcgttgcctcgatttgtggggcggcgtccgagcgccctatatggacgcaac
gcccctgctattaagcccaagaagtacaactgcccgctcaagtcccccggcgtgcgcccg
tcctcggtgcgcccgggcaccatgcgccatccgacgccactgcagaatgagccgcgcaag
atcagctacagccgcatccctgatagcgagatggagagcgccgcttctgcacccaactcg
ccgcgcacgcccctcactccgccgccagcctcggctgcctccagctccacagatatcggc
agcgtgttcgactccccccagggcccctccagccccttccactccaactgcgacagcgtc
tttgtccaggtctccttaccacatggcccacggtcctcctcggtttcctccatggtgagt
ctccacaggaacactgaagacaccaccgtccccccgcctgtgccccctcgcagacgcccc
gaatccgcccccgctgaatcttccccatcgaagatgatgtcaaagcacttggacagcccc
cccgccatccccccacggcagcccaccaccaccaaggtctactcgcctcgctactcgctc
tcgaccgagcgcacctccgtgtcggagccgcctgacagcccacccaccctgccgccgcgg
gagcccatgagaacgccggacgtcttctccagctccaacagccccctgcacctgcagccc
cccccgctgggccgcatccgcagcagcgaacccacgctgagccagaccttcttcccaccc
tcgccgttcggcccactcaccccgccgccgccccccactccctcgccctcgctgggccca
cgcaagcacctgccctccccacccttgccactgctggggcccagtggcccagactgctgc
ggcgactcagccctcctccctctggggggtgcagctggcccccctgtgccccctcgccag
agcaccagcagtgccgccgcccaagctatccccaagctccctcccaaaacgtacaaaagg
gagtcggtgtcacacccgtcgctagtgcatcgggacgacccacccgtgctggagaatgcc
aacccctcttaa

KEGG   Salmo salar (Atlantic salmon): 106601599
Entry
106601599         CDS       T04363                                 

Gene name
sos2
Definition
(RefSeq) SOS Ras/Rho guanine nucleotide exchange factor 2
  KO
K03099  son of sevenless
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106601599 (sos2)
   04012 ErbB signaling pathway
    106601599 (sos2)
   04068 FoxO signaling pathway
    106601599 (sos2)
   04150 mTOR signaling pathway
    106601599 (sos2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106601599 (sos2)
   04540 Gap junction
    106601599 (sos2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106601599 (sos2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106601599 (sos2)
   04912 GnRH signaling pathway
    106601599 (sos2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106601599 (sos2)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   106601599 (sos2)
SSDB
Motif
Pfam: RasGEF RasGEF_N Histone RhoGEF PH
Other DBs
NCBI-GeneID: 106601599
NCBI-ProteinID: XP_014049443
UniProt: A0A1S3RAQ0
LinkDB
Position
ssa01
AA seq 1264 aa
MQPQQIYDFSSDENSHKWRGLFVQALRKVQLQVHPNLSAKEGALQHIEELILQLLNMLCM
AQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
IDYHVCLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKDVEVIFSNILD
IHELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDILSRQFREHF
SSLMARPTVGLYFQSIAEGFKEAVQYVLPQLMMVPVYHCLHYFELLQQLQEHSEEQDDRE
CLKQAITALLNLQCSVERIYTKHLPRRKPGEPMYRLYSRQVRSKQLAIKRMNEIQKSIDG
WEGKDIGQCCSEFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGSGSGAEFRLK
EKFVLRKVRIVDREDSAEFKHAFELAGKDENCVVFCARSAEEKGAWMAALVTLQYRSTLD
RMLDTVLQHEEQAQPLRLPSPELYRFAVHDSEENIVFEDRVQSKTGIPIIKAGTVVKLIE
RLTYHMYADPNFVRTFLTTYRSFCKPQELLGLLIDRIEIPEPEPTEADKQALWNGDQPMA
AELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELRGRLEEYISSIIQLRGKSMRK
WVESINKIIKRKMQTQSNGVSHNITFESPPPPIEWHISRLGQTDTFDLMTLHPIEIARQL
TLLESELYRAVRPSELVGSVWTKEDKENNSPNLLRMIRHTTNLTLWFEKCIVEAENLDER
VAVFTRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAVPERKKRILEEAVELS
QDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINFSKRRKVAEIT
GEIQQYQNQPYCLKVQQDIKRFFENLNPMGSLGEKEFSDYLFNKSQEIEPRNCKQPPRFP
RKTMYTLKSPGIRPVRTSTSGTLKGHPVPLEREPPHKITFRSIAETEHEISSTASVPTSP
NTPTPPQSATSDLISVFMEQDLCNSYGGNSIFANVLLPPSKVQSVSCGSLHQLGEDLLKP
PPLPPRRKDAFSETKLSSRSDSPPAIPPRLPPPLPRIQPRVPVYNGPSDGPLSSPPLPPP
RDPQPDTPPPVPQRPPEIFINYPLNLQPSPVGRFHWDFCSSPSSPGTPPGTPSPRVPRRS
CPLSASQNSLCPLPLPIMAPPVPPRHNSNSSPQLPKLPPKTYKRELLPPPLQSLSLVENT
DTSQ
NT seq 3795 nt   +upstreamnt  +downstreamnt
atgcagccgcaacaaatatacgacttttcaagtgacgagaacagtcacaaatggcgaggc
ctcttcgtccaagcgttgcgaaaggtgcagctacaggtgcaccccaacctgtcagccaag
gagggagctctgcagcacatcgaagagctgatcctgcagctgctcaacatgctgtgtatg
gcccagccgcgctctgtacaggacgtggaggagcgggtccagaagaccttcccccacccc
atagataaatgggccatagctgacgcccagtcggccatcgagaagaggaagaggaggaac
cctctactgctccccgtcgataagatacaccccctactcaaggaggtcctgggttataag
atagactaccacgtctgcctctacatcgtggcggtgctagaatacatatcagctgacatc
ttgaagctagcaggaaactacgttggtaacatcagacactatgagatcagccagcaagac
atcaaagtgtccatgtgtgcagacaaggatgtggaggtgattttcagtaacatcttggac
atccatgagttgacggtcaagctgctgggcctgatcgaagatgcggtggagatgaccgct
gacggtagtccacatcctttggtgggcagctgcttcgaggacctggcagaggaacaggcg
tttgatccgtacgagaccctgtctcaggatatcctgtccaggcagttccgcgagcacttc
agcagcctcatggcccggcctactgtaggactatacttccagtccatagctgaaggtttc
aaggaggcggttcagtacgtcctgccacagcttatgatggttcctgtataccactgtttg
cactactttgaactactgcagcagctgcaggagcacagcgaggagcaggatgacagggag
tgtttgaagcaggccatcacagctctgctcaacctccagtgtagcgtggaacgcatctac
accaaacacctgcctcgacgcaaacctggagagcccatgtaccgtctgtacagccgtcag
gtgcgcagcaagcagctggccatcaagcggatgaacgagatccagaagagcatcgacggc
tgggagggcaaggacatcggccagtgctgttccgagtttatcctggagggggcgctcctc
cgcgccggcgccaaacacgagcgacacaacttcctgttcgacggcctcatgatcagctgc
aaggccaatcagagctcccgactccccggttctggaagcggggcggagttccgtctcaag
gagaagttcgtcctgcggaaagtccgcatcgtggaccgcgaggactcggcggagttcaaa
cacgccttcgaactcgccggtaaagacgagaactgtgtggtgttctgcgcccgctcggcg
gaggagaagggggcgtggatggcggcgctggtgaccctgcagtaccgctccacgctggac
cgtatgttggacacggttctgcaacacgaggagcaggcccagcccctacgactgccctcg
ccagagctataccgcttcgctgtgcatgactcagaggagaacatcgtgtttgaagatcgc
gtccagagcaagacggggatacccattattaaagctggcacggtggtcaagcttatagag
aggctcacctaccacatgtatgctgatcccaactttgtgcgcacttttctgaccacctac
cggtccttttgcaagccccaggagctcctcggcctcttgatagacaggattgagatccca
gagccggagcccactgaggcagacaagcaggctctatggaacggagatcagccaatggct
gcagagctgcagaggttccggagggagtacgtccaaccagtccaactcagggtcctgaat
gtgttccgtcaatgggtggaacatcatttctatgactttgagaacgaccctgagctacga
ggcagactggaggagtacatcagcagcattatacagctacgaggcaagtctatgaggaag
tgggtggagtctatcaacaagataatcaagaggaagatgcagactcagtctaacggggtc
agccacaacatcaccttcgagagcccgcccccgcccatcgagtggcacatcagccgcctg
ggccagactgacacctttgacctcatgacccttcaccccatagagatcgcccgccagctc
accctgttggagtcagagctatacagggctgtgaggccatctgagctggtggggagtgtc
tggaccaaagaggacaaggagaataactctcccaacctgctgaggatgatccgtcacacc
accaacctcacactgtggtttgagaagtgtattgtggaagcagagaacctggatgagagg
gtagcagtgttcacacgggtcattgagatccttcaggtgtttcaggagctcaacaacttc
aacggtgttctggaggtggtctctgccatcaactctgtccccgtctaccggctagatcac
accttcgaggcggtccccgagaggaaaaagaggatcctagaggaagcagtggaactgagc
caggaccatttcaagaagtacctggccaagctcaagtccattaacccaccctgtgtgcct
ttcttcggtatctacttgaccaacatcctgaagacagaggaggggaaccccgacttcctg
aagagacacggcaaagagctgatcaacttcagtaagaggaggaaagtagcagaaatcaca
ggagagatacagcagtaccagaaccagccttactgtctcaaggtccagcaggacatcaag
aggttttttgagaacctgaacccgatgggcagtctgggtgagaaggagttctcggactat
ctgttcaacaagtctcaggagattgagcctcgcaactgcaagcagccgccacgattcccc
aggaagaccatgtacacactgaagtccccggggatccggccggtgcgtacctctacgtca
gggaccctgaagggtcaccccgtacccctggagagagagcccccccacaagatcaccttc
aggagcatcgctgagacggagcatgagatctcttccacagcctcggtccccacctcaccg
aacacccccacacccccgcagtctgcaacctcagacctcatctctgtcttcatggagcaa
gacctctgcaactcctacggtggaaactccatattcgctaatgttctcctcccaccctca
aaggtccagtcagtatcttgtggaagccttcaccagctaggagaggacttactcaaacct
cctccacttcccccacgcaggaaggatgctttctctgagaccaagttgagttccaggtct
gatagtcctccagccatcccccccaggctaccccctcctctccccaggatccagccccgc
gtcccggtctacaacggccccagcgacggccccctctccagccccccactaccacctccc
cgggacccccagccagacacccctccacccgtcccccagagacccccagagatcttcatc
aactaccccttgaaccttcaaccctcccctgtcggacgcttccactgggacttttgcagc
tccccgtcgtcccccggcacgcccccgggcaccccgtctccccgcgtcccccgacggagc
tgcccactcagcgccagtcagaacagtctctgcccgctcccgctgcccatcatggcgccc
cccgtgccccctcgccacaactccaactcctccccccagctccccaaactccccccaaag
acctacaagagggagctgttgccgcccccattacagagcctctcattggtggagaacacg
gacactagccaatga

KEGG   Salmo salar (Atlantic salmon): 106611443
Entry
106611443         CDS       T04363                                 

Definition
(RefSeq) son of sevenless homolog 2-like
  KO
K03099  son of sevenless
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106611443
   04012 ErbB signaling pathway
    106611443
   04068 FoxO signaling pathway
    106611443
   04150 mTOR signaling pathway
    106611443
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106611443
   04540 Gap junction
    106611443
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106611443
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106611443
   04912 GnRH signaling pathway
    106611443
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106611443
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   106611443
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH
Other DBs
NCBI-GeneID: 106611443
NCBI-ProteinID: XP_014067111
UniProt: A0A1S3SRZ5
LinkDB
Position
ssa09
AA seq 961 aa
MQPQQIYDFSSDENSHKWRGLFVQALRKVQLQVHPTLSAKEGALQHIEELILQLLNMLCV
VQPRSVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
IDYHVCLYIVAVLEYISADILKLAGNYVGNIRHYEISQQDIKVSMCADKVLMDMFDQDED
MGLVSQCTEEPSSSGELTYDDLVRLEIAEERQYLRELDLIIKVFRHHFLFNNKIFTPQDV
EVIFSNISDIHELTVKLLGLIEDAVEMTADTSPHPLVGSCFEDLAEEQAFDPYETLSQDI
LSRQFHEHFSSLMARPTVGLYFQSIAEGFKEAVQYVLPQLMMVPVYHCLHYFELLQQLQE
HSEEQDDREGLKQAITALLNLQCSVERIYTKHLPRRKPGEPMYRLYSRQVRSKQLAIKRM
NEIQKSIDGWEGKDIGQCCSEFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGS
GSGAEFRLKEKFVLRKVRIVDREDSAELKHAFELVGKDENCVVFCARSAEEKGAWMAALV
TLQYRSTLDRMLDTVLQHEEQAQPLRLPSPELYRFAVHDSEENIVFEDRVQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLRLLIDRIEIPEPEPTEADKQA
LWNGDQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELRGKLEEYISSIL
QLRGKSMRKWVESINKIIKRKMQTQSNGVSHNITFESPPPPIEWHISRLGQTDTFDLMTL
HPIEIARQLTLLESELYRAVRPSELVGSVWTKEDKENNSPNLLRMIRHTTNLTLWFEKCI
VEAENLDERVAVLTRVIEILQVFQELNNFNGVLEVVSAINSVPVYRLDHTFEAVPERKKR
ILEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRHGKELINFS
K
NT seq 2883 nt   +upstreamnt  +downstreamnt
atgcagccgcaacaaatatacgacttttcaagtgacgagaacagtcacaaatggcgaggc
ctcttcgtgcaagcgttgcgaaaggtgcagctgcaggtgcaccccaccctgtcagccaag
gagggagctctgcagcacatcgaagagctgatcctgcagctgctcaacatgctgtgtgtg
gtccagccacggtctgtacaggacgtggaggagcgtgtccagaagaccttcccccacccc
atagataaatgggccatagctgacgcccagtcggccatcgagaagaggaagaggaggaac
cccctactgctccctgttgataagatacaccctctactcaaggaggtgctgggttataag
atagactaccacgtctgcctctacatcgtggcggtgctagagtacatatcagctgacatc
ctgaagctagcaggaaactacgttggtaacatcagacactatgagatcagccagcaagac
atcaaggtgtccatgtgtgcagacaaggtcctaatggacatgtttgaccaggacgaggac
atgggtctggtgtctcagtgtacggaggagccgtcgtcgtcgggggagctgacctacgat
gacctggtgcgcttggagatcgcagaggagcgccagtacctacgggagctcgacctcatc
atcaaggtgttccgacatcacttcctgttcaacaacaaaatcttcacgcctcaggatgtg
gaggttatcttcagtaacatttcagacattcatgagctgacggtcaaacttctcgggctg
atagaggatgcggtggagatgaccgctgacactagccctcatcctctggtgggcagctgc
ttcgaggacctggcagaggagcaagcgtttgatccgtacgagaccctgtcacaggatatc
ctgtccagacagttccacgagcacttcagcagcctgatggcccggcctactgtaggacta
tacttccagtccatagctgaaggtttcaaggaggcagttcaatacgtcctgccacagctc
atgatggttcctgtataccactgtttacactactttgaactactgcagcagctgcaggag
cacagcgaggagcaggatgaccgagagggtttgaagcaggccatcaccgctctgcttaac
ctccagtgtagcgtggaacgcatctacaccaaacacctgccccgacgcaagcctggtgag
cccatgtaccgcctgtacagccgtcaggtgcgcagcaagcagctggccatcaagaggatg
aacgagatccagaagagcatcgacggctgggaggggaaggacatcggccagtgctgttcc
gagttcatcctggagggggcgctcctccgagccggcgccaaacacgagcgacacaacttc
ctgtttgacggcctcatgatcagctgtaaggccaatcagagctcccgactccccggctcc
ggaagcggggcggagtttcgtctcaaggagaagttcgtcctacggaaagtccgcatcgtg
gaccgcgaggactcggcggagttaaaacacgccttcgaactcgtcggtaaagacgagaac
tgtgtggtgttctgcgcccgctcggcggaggagaagggggcgtggatggcggcgctggtc
accctgcagtatcgctccacactggaccgtatgctagacactgtcctacagcatgaggag
caggcccagcccctccgcctgccttccccggagctttaccgcttcgctgtgcacgactct
gaggagaacatcgtgtttgaggaccgtgtccagagcaagacggggatacctattattaag
gctgggacggtggtcaagcttatagagaggcttacataccacatgtacgctgatcccaac
tttgtacgcacctttctgaccacctaccggtcattttgcaagccccaggagctcctgagg
ctgttgatagacaggattgagatccccgagccagagcccacagaggcagacaaacaggct
ctatggaatggggatcagccaatggctgcagagctacagaggttccgcagggagtacgtc
caacccgtccaactcagggtcctgaatgtgtttcgtcagtgggtggaacatcatttttat
gactttgagaacgaccccgagctacgaggcaaactggaggagtacatcagcagcattcta
cagctccgaggcaagtctatgaggaagtgggtggagtccatcaacaagatcatcaagagg
aagatgcagactcagtctaacggggtcagccacaacatcaccttcgagagcccgcccccg
cccatcgagtggcacatcagccgcctgggtcagacggacacctttgacctgatgaccctt
caccccatagagatcgcccgccagctcaccctgcttgagtctgaactctacagggctgtg
aggccgtctgagttggtggggagtgtgtggaccaaagaggacaaggagaataactctccc
aacctgctgaggatgatccgtcacaccaccaacctcacgctgtggttcgagaagtgtatt
gtggaagcagagaacctggatgagagagtagcagtgttaacgcgggtcattgagatcctt
caggtgtttcaggagctcaacaacttcaacggtgttctggaggtggtctctgccatcaac
tctgtccccgtctaccggctcgaccacaccttcgaggcggtccccgagaggaaaaagcgg
atcctagaggaagcagtggaactgagccaggaccatttcaagaagtacctggccaagctc
aagtccattaacccgccctgtgtgcctttctttggtatctacctgaccaacatcctgaag
acagaggaggggaaccccgacttcctgaagagacacggcaaagagctgatcaacttcagt
aag

DBGET integrated database retrieval system