KEGG   Salmo salar (Atlantic salmon): 106564903
Entry
106564903         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2-like
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106564903
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106564903
   04350 TGF-beta signaling pathway
    106564903
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106564903
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106564903
   04121 Ubiquitin system [BR:sasa04121]
    106564903
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106564903
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     106564903
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106564903
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106564903
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   106564903
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    106564903
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 106564903
NCBI-ProteinID: XP_013986875
UniProt: A0A1S3L7T4
LinkDB
Position
ssa12
AA seq 796 aa
MSNQGVRRNGPVKLRLTVLCAKNLSKKDFFLVNTILHFGSSSTGLPDPFAKVVVDGSGQC
HSTDTVRNTLDPKWNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRL
KDTGYQRLDLNKLGPNDNDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERR
TASGRIQYLNHITRTTQWERPTRPASEYSSPSGRPLSCVVDENTPVMTPNGAAIGVLPSS
GNDPRVQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDP
RVPRDLSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPNG
PGPNGSRVAMESQSQNTNISSRQSNQLKEQQPPPQVPALSPAQLPEEAECLTVPKYKRDL
VQKLKILRQELSNQQPQAGHCRIEVCREEIFEESYRQVMKMRPKDLWKRLMVKFRGEEGL
DYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGM
AVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLVWILDNDITGVLDHTFCVE
HNAYGEIIQHELKPNGKTVSVSEDTKKEYVRLYVNWRFLHGIEAQFLALQKGFNEVIPQH
LLKSFDEKELELIVCGLGKIDIADWKSNTRLKHCTTDSNVVKWFWKAVESYDEERRARLL
QFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDANTNNLPKAHTCFNRIDVPAYEHYDKLY
DKLLTAIEETCGFAVE
NT seq 2391 nt   +upstreamnt  +downstreamnt
atgtctaatcaaggagttaggagaaatggcccagtgaaactgcggttgacagtgctgtgt
gcgaagaacttgtcaaagaaagacttcttccttgtgaatacaatcctccattttggctcc
tcctccacagggctgcctgacccctttgccaaagtggtggtggacggctcggggcaatgc
cactccacggacaccgtgaggaacacgctggaccccaagtggaaccaacattacgacctg
tacattgggaagtctgactccatcaccatcagtgtgtggaaccacaagaagattcacaag
aagcagggggctggcttcctgggctgtgtacgccttctctccaacgccatcaaccgcctc
aaagacaccggctatcagagactggacctgaacaagctgggccccaatgacaacgacaca
gtgagaggccagatagttgtgagtctacagtccagagaccgtatcggcacaggaggcccc
gtggtggactgcagccgtctgtttgataatgatttacctgatggctgggaggagcggaga
acagcctctggtcggatccagtaccttaaccacatcacacgcaccacgcaatgggagagg
cccacccggccggcgtctgagtactccagcccctccgggcggcccctcagctgcgtggtg
gatgagaacacgccggtcatgacacccaacggggcagccatcggtgtgctgcccagcagt
ggcaatgacccgcgggtccaggagagacgggtccgctcccagagacacaggaactacatg
agcaggacccacctccacaccccgccggacctgccagagggatacgagcagagaaccacg
cagcagggccaggtgtacttcctccacacccagacgggtgtcagcacatggcacgaccct
cgagtgcccagagatctgagcaacgtcaactgtgaggagctgggtcctctgccgccgggc
tgggagatccgcaacacggcaacgggacgcgtgtactttgtggaccacaacaaccgaacc
acgcagttcaccgacccgcgcctctccgccaacctccacctggtcctcaatccaaacggc
cctggtccaaacggttcccgcgtggccatggagagccagagccagaacactaacatcagt
agtcgtcagtcgaaccagttgaaggagcagcagccccccccgcaggtcccggcgttgtcc
ccggcccagctccccgaggaggcggagtgcctcaccgtgcccaagtacaagagggacctg
gtccagaagctcaagatcctccggcaggagctgtccaatcagcagccccaggcaggacac
tgtcgcatcgaggtctgccgcgaagagatctttgaggagtcataccgccaggtgatgaag
atgcgtcccaaggacctgtggaagagactgatggtcaagttcagaggagaggagggcctt
gactacggaggagtggccagggagtggctgtatctgctgtcccatgagatgttgaacccc
tactacggcctgttccagtactccagagacgacatctacaccctgcagatcaacccagac
agcgccgtcaacccagagcacctgtcctacttccactttgtgggtcgtatcatgggcatg
gcggtgttccacggccactacatagacgggggcttcaccctgcccttctacaaacagctg
ctggggaaacccatcactctggacgatatggagtcagtggacccagacctccacaacagc
ctggtctggatcctggacaatgacatcacgggggtgctggaccatacgttctgtgtggag
cacaatgcctacggagagatcatccagcacgaactgaagcccaacggcaagactgtctca
gtctccgaggacaccaagaaggagtatgtcaggctctatgtgaactggcggttcctccac
ggcatcgaggctcagttcctggccctgcagaaaggcttcaacgaggtcatcccccagcac
ctgctcaagtcctttgacgagaaggaactagagttgatagtgtgtggcctggggaagatc
gacatagcggactggaagagcaacacgcgcctgaagcactgcaccacggacagcaacgtg
gtcaagtggttctggaaggccgtggagtcctacgacgaggagaggagggccagactgctg
cagtttgttaccgggtcatctagagtcccactgcagggattcaaggctttacaaggtgcc
gcggggcccaggctcttcacaatccaccagatcgatgccaacaccaacaatctacccaaa
gcccacacctgctttaaccggattgacgttcccgcctacgagcactatgataagctgtac
gacaagctgctgacagccatcgaggagacgtgtggctttgcggtggaatga

KEGG   Salmo salar (Atlantic salmon): 106588327
Entry
106588327         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2-like
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106588327
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106588327
   04350 TGF-beta signaling pathway
    106588327
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106588327
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106588327
   04121 Ubiquitin system [BR:sasa04121]
    106588327
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106588327
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     106588327
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106588327
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106588327
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   106588327
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    106588327
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 106588327
NCBI-ProteinID: XP_014032676
UniProt: A0A1S3PYH4
LinkDB
Position
ssa02
AA seq 801 aa
MSNQGVRRNGPVKLRLTVLCAKNLSKKDFFLVNTILHFGSSSTGLPDPFAKVVVDGSGQC
HSTDTVRNTLDPKWNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRL
KDTGYQRLDLNKLGPNDNDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERR
TASGRIQYLNHITRTTQWERPTRPASEYSSPSGRPLSCVVDENTPVMTPNGAAIGVLPSS
GSDPRVQERRVRSQRHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDP
RVPRDLSNVNCEELGPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPNG
PGPNSPGPNGSRVAMESQSQNTNLSSRQSNQLKEQQPPPQVPALSPAQLPEEAECLTVPK
YKRDLVQKLKILRQELSNQQPQAGHCRIDVCREEIFEESYRQVMKMRPKDLWKRLMVKFR
GEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYFHFVG
RIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMESVDPDLHNSLVWILDNDITGVLDH
TFCVEHNAYGEIIQHELKPNGKTVSVSEDTKKEYVRLYVNWRFLHGIEAQFLALQKGFNE
VIPQHLLKSFDEKELELIVCGLGKIDIADWKSNTRLKHCTTDSNVVKWFWKAVESYDEER
RARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDANTNNLPKAHTCFNRIDVPAYEH
YDKLYDKLLTAIEETCGFAVE
NT seq 2406 nt   +upstreamnt  +downstreamnt
atgtctaatcaaggagttaggagaaatggcccagtgaaactgcggttgacagtgctgtgt
gcgaagaacttgtcgaagaaagacttcttccttgtgaatacaatcctccattttggctcc
tcctccacagggctgcctgacccctttgccaaagtggtggtggacggctcggggcaatgc
cactccacagacaccgtaaggaacacgctggaccccaagtggaaccaacattacgacctg
tacattgggaagtctgactccatcaccattagtgtgtggaaccacaagaagattcacaag
aagcagggggccggcttcctgggctgtgtacgccttctctccaacgccatcaaccgcctc
aaagacaccggctatcagagactggacctgaacaagctgggccccaatgacaacgacaca
gtgagaggccagatagttgtgagtctacagtccagagaccgtatcggcacaggaggcccc
gtggtggactgcagccgtctgtttgataatgatttacctgacggctgggaggagaggaga
acagcctctggtcggatccagtaccttaaccacatcacacgcaccacgcaatgggagagg
cccacccggccggcgtctgagtactccagcccctccgggcggcccctcagctgcgtggtg
gatgagaacacgccggtcatgacgcccaacggggcggccatcggtgtgctgcccagcagt
ggcagtgacccgcgggtccaggagagacgcgtccgctcccagagacacaggaactacatg
agcaggacccacctccacaccccgccggacctgccagagggatacgagcagagaaccacg
cagcagggccaggtgtacttcctccacacccagacgggcgtcagcacatggcacgacccc
cgagtgcccagggatctgagcaacgtcaactgtgaggagctgggtcctctgccgccgggc
tgggagatccgcaacacggcaacgggacgcgtctactttgtggaccacaacaaccgaacc
acgcagttcaccgacccgcgcctctccgccaacctccacctggtcctcaatccaaacggc
cctggtccaaacagccctggtccaaacggttcccgcgtggccatggagagccagagccag
aacactaacctcagtagtcgtcagtcgaaccagttgaaggagcagcagccccccccgcag
gtcccggcgttgtccccggcccagctccccgaggaggccgagtgcctcaccgtgcccaag
tacaagagggacctggtccagaagctcaagatcctccggcaggagctgtccaatcagcag
ccccaggcaggacactgtcgcatcgacgtctgccgcgaggagatctttgaggagtcgtac
cgccaggtgatgaagatgcgtcccaaggacctgtggaagagactaatggtcaagttcaga
ggagaggagggcctggactacggaggagtggccagggagtggctgtacctgctgtcccat
gagatgttgaacccctactacggcctgttccagtactccagagacgacatctacaccctg
cagatcaacccagacagcgccgtcaacccggagcacctgtcctacttccactttgtgggt
cgtatcatgggcatggcggtgttccatggccactacatagacgggggcttcaccctgccc
ttctacaaacagctgctggggaaacccatcaccctggacgacatggagtcagtggaccca
gacctccacaacagcctggtctggatcctggacaatgacatcacgggggtgctggaccat
acgttctgtgtggagcacaatgcctacggcgagatcatccagcatgaactgaagcccaac
ggcaagactgtctcagtctccgaggacaccaagaaggagtatgtcaggctgtatgtgaac
tggcgtttcctccatggcatcgaggctcagttcctggccctgcagaagggcttcaacgag
gtcatcccccagcacctgctcaagtcctttgacgagaaggaactagagttgatagtgtgt
ggcctggggaagatcgacatagcagactggaagagcaacacgcgcctgaagcactgcacc
acggacagcaacgtggtcaagtggttctggaaggccgtggagtcctacgacgaggagagg
agagccagactgctgcagtttgttaccgggtcatctagagtcccactgcagggattcaag
gctttacaaggtgccgcggggcccaggctcttcaccatccaccagatcgatgccaacacc
aacaatctacccaaagcccacacctgctttaaccggattgacgttcccgcctacgagcac
tatgacaagctgtacgacaagctgctgacagccatcgaggagacgtgtggctttgcggtg
gaatga

KEGG   Salmo salar (Atlantic salmon): 106601396
Entry
106601396         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106601396
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106601396
   04350 TGF-beta signaling pathway
    106601396
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106601396
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106601396
   04121 Ubiquitin system [BR:sasa04121]
    106601396
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106601396
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     106601396
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106601396
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106601396
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   106601396
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    106601396
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 106601396
NCBI-ProteinID: XP_014049045
UniProt: A0A1S3R9L0
LinkDB
Position
ssa03
AA seq 772 aa
MSNQGVRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDMNKL
GLNDSDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCIVDENTPILSTNGATPTIPCVPSSDQRAQERRVRSQ
RHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEEL
GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSPNGSRSGIEIQNSPI
SRQTQLKEQAQQALVSPGNLPEEAECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRIE
VSREEIFEESYRQVMKMRPKDLWKRLMVKFKGEEGLDYGGVAREWLYLLSHEMLNPYYGL
FQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKP
ITLDDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPNGKIIQVTQD
TKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVISQHLLKAFDEKELELIVCGLGKIDIND
WKSNTRLKHCTPDTNIVKWFWKAVESYDEERRARLLQFVTGSSRVPLQGFKALQGAAGPR
LFTIHQIDASSNNLPKAHTCFNRIDIPPYENYDKLYDKLLTAIEETCGFAVE
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtctaaccaaggagttcggcgaaatggtccggttaaactgcgcttaacagtcctctgc
gccaaaaacctggtgaagaaagatttctttcgcctccctgatccctttgccaaagtggtg
gtggacggctcaggacagtgtcactccacagacaccgtgaagaacaccctcgaccccaag
tggaaccagcactacgacctatatattggcaagtctgactccatcaccatcagtgtgtgg
aaccacaagaagatccataagaagcagggggctggcttcctgggctgtgtacgccttcta
tccaacgccatcaaccgcctcaaagacaccggctatcagagattggacatgaacaagctg
ggcctcaatgacagtgacacagtgaggggtcagatagtggtgagcctgcagtccagagac
aggataggcacaggaggcccagtggtggactgcagccgtctgtttgacaacgacctgcca
gacggctgggaggagcggaggactgcgtctggccgaatccagtacttgaaccacatcaca
cgcaccacacagtgggagaggcctaccaggcctgcgtcggagtactccagccccggccgg
cctctcagctgcatcgtggatgagaacacgcccatcctgagcaccaacggggccacgccc
accattccgtgtgtcccgtccagcgaccagcgggcccaggagagacgcgtccgctcccag
agacacaggaactacatgagcaggacacacctccacacacccccagacctgcctgaggga
tacgagcagaggaccacgcagcagggccaggtctacttcctccacacccagacaggagtc
agcacatggcacgaccctcgagtgcccagagacctgagtaatgtaaactgtgaggagctg
ggcccactgccccctggctgggagatcaggaacacagccactggccgggtctactttgtg
gaccacaacaaccgcaccacgcagttcacagacccgcgcctctccgccaacctgcatcta
gtccttaacccaagccccaatggttcccgcagcggcatcgaaattcagaacagtccgatc
agccgtcagacccagctgaaggagcaggcccagcaggcactggtgtctccaggtaatctg
ccagaggaggccgagtgcctcacggtgcccaagtacaagagggacctggtgcagaagctg
aagatcctccgccaggagctgtcccagcagcagccccaggcaggccactgccgcatagag
gtgtcccgcgaggagatctttgaggagtcttaccgccaggtgatgaagatgaggccgaag
gacctgtggaagagactgatggtgaagtttaaaggggaggaggggctggactacggagga
gtggccagggagtggctgtatctgctgtcccatgagatgctgaatccgtactacgggctg
ttccagtactcccgcgatgacatctacaccctgcagattaaccccgactcggccgtcaac
ccggagcacctgtcctacttccactttgtgggtcgtatcatgggcatggcggtgttccac
ggccactacatagacgggggcttcaccctgcccttctacaaacagctgctggggaaaccc
atcaccctggacgacatggagtcagtggacccagacctccacaacagcctggtctggatc
ctggacaatgacatcacaggcgtgttggaccacaccttctgtgtggagcacaatgcctac
ggggagatcatccagcacgaactcaaacccaacggcaaaatcatccaggtcacccaggac
accaagaaggagtatgtcagactgtatgtgaactggcgtttcctgcgaggcatcgaggct
cagttcctggccctgcagaagggcttcaacgaggtcatctcccagcacctcctcaaggcc
ttcgacgagaaagagctggagctcatagtgtgtggcctgggtaagatcgacatcaacgac
tggaagtccaacacgcggctgaagcactgcacccccgacaccaacatcgtcaagtggttc
tggaaggccgtggagtcgtacgatgaggagcgccgggccaggttgctgcagtttgtcacc
ggctcctccagggtccccctgcaaggcttcaaagccctccaaggtgctgcaggcccacga
ctcttcaccatccaccagatcgatgccagctccaacaacctgcccaaagcccacacctgc
ttcaaccggatcgacattcctccctacgagaactatgacaagctgtatgacaagctgctc
actgctatcgaggagacgtgtggctttgctgtggagtga

KEGG   Salmo salar (Atlantic salmon): 106607065
Entry
106607065         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2-like
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106607065
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106607065
   04350 TGF-beta signaling pathway
    106607065
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106607065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106607065
   04121 Ubiquitin system [BR:sasa04121]
    106607065
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106607065
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     106607065
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    106607065
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106607065
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   106607065
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    106607065
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 106607065
NCBI-ProteinID: XP_014059115
UniProt: A0A1S3S426
LinkDB
Position
ssa06
AA seq 772 aa
MSNQGVRRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDMNKL
GLNDSDTVRGQIVVSLQSRDRIGTGGPVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCIVDENTPILSTNGATPTIPCVPSSDQRAQERRVRSQ
RHRNYMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNVNCEEL
GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNPSPNGSRSGIEIQNSPI
SRQTQLKEQAQQALVSPGNLPEEAECLTVPKYKRDLVQKLKILRQELSQQQPQAGHCRIE
VSREEIFEESYRQVMKMRPKDLWKRLMVKFKGEEGLDYGGVAREWLYLLSHEMLNPYYGL
FQYSRDDIYTLQINPDSAVNPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKP
ITLDDMESVDPDLHNSLVWILDNDITGVLDHTFCVEHNAYGEIIQHELKPNGKIIQVTQD
TKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVISQHLLKAFDEKELELIVCGLGKIDIND
WKSNTRLKHCTPDTNIVKWFWKAVESYDEERRARLLQFVTGSSRVPLQGFKALQGAAGPR
LFTIHQIDANSNNLPKAHTCFNRIDIPPYENYDKLYDKLLTAIEETCGFAVE
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtctaaccaaggagttcggcgaaatggtccggttaaactgcgtttaacagtcctctgc
gccaaaaacctggtgaagaaagatttctttcgcctccctgatccctttgccaaagtggtg
gtggatggctcaggacaatgtcactccacagacaccgtgaagaacaccctcgaccccaag
tggaaccagcactacgacctatatattggcaagtctgactccatcaccatcagtgtgtgg
aaccacaagaagatccataagaagcagggggctggcttcctgggctgtgtacgccttcta
tccaacgccattaaccgcctcaaagacaccggctatcagagattggacatgaacaagctg
ggcctcaatgacagtgacacagtgaggggtcagatagtggtgagcctgcagtccagagac
aggataggcacaggaggcccagtggtggactgcagccgtctgtttgacaacgacctgcca
gacggctgggaggagcggaggactgcgtctggccgaatccagtacttgaaccacatcaca
cgcaccacacagtgggagaggcctaccaggcctgcgtcggagtactccagccccggccgg
cctctcagctgcatcgtggatgagaacacgcccatcctgagcaccaacggggccacgccc
accattccgtgtgtcccgtccagcgaccagcgggcccaggagagacgcgtccgctcccag
agacacaggaactacatgagcaggacacacctccacacacccccagacctgcctgaggga
tacgagcagaggaccacgcagcagggccaggtctacttcctccacacccagacaggagtc
agcacatggcacgaccctcgagtgcccagagacctgagtaatgtaaactgtgaggagctg
ggcccactgccccctggctgggagatcaggaacacagccactggccgggtctactttgtg
gaccacaacaaccgcaccacgcagttcacagacccgcgcctctccgccaacctgcatcta
gtccttaacccaagccccaatggttcccgcagcggcatcgaaattcagaacagtccgatc
agccgtcagacccagctgaaggagcaggcccagcaggcactggtgtctccaggtaatctg
ccagaggaggccgagtgcctcacggtgcccaagtacaagagggacctggtgcagaagctg
aagatcctccgccaggagctgtcccagcagcagccccaggcaggccactgccgcatagag
gtgtcccgcgaggagatctttgaggagtcttaccgccaggtgatgaagatgaggccgaag
gacctgtggaagagactgatggtgaagtttaaaggggaggaggggctggactacggagga
gtggccagggagtggctgtatctgctgtcccatgagatgctgaatccgtactacgggctg
ttccagtactcccgcgatgacatctacaccctgcagattaaccccgactcggccgtcaac
ccggagcacctgtcctacttccactttgtgggtcgtatcatgggcatggcggtgttccac
ggccactacatagacgggggcttcaccctgcccttctacaaacagctgctggggaaaccc
atcaccctggacgacatggagtcagtggacccagacctccacaacagcctggtctggatc
ctggacaatgacatcacaggcgtgttggaccacaccttctgtgtggagcacaatgcctac
ggggagatcatccagcacgaactcaaacccaacggcaaaatcatccaggtcacccaggac
accaagaaggagtatgtcaggctgtatgtgaactggcgtttcctgcgaggcatcgaggct
cagttcctggccctacagaagggcttcaacgaggtcatctcccagcacctgctcaaggct
ttcgacgagaaagagctggagctcatagtgtgtggcctgggtaagatcgacatcaacgac
tggaagtccaacacgcggctgaagcactgcacccccgacaccaacatcgtcaagtggttc
tggaaggccgtggagtcgtacgatgaggagcgccgggccaggttgctgcagtttgtcacc
ggctcctccagggtccccctgcaaggcttcaaagccctccaaggtgctgcaggcccacga
ctcttcaccatccaccagatcgatgccaactccaacaacctgcccaaagcccacacctgc
ttcaaccggatcgacattcctccctacgagaactatgacaagctgtatgacaagctgctc
actgctatcgaggagacgtgtggctttgctgtggagtga

DBGET integrated database retrieval system