KEGG   Salmo salar (Atlantic salmon): 106565074
Entry
106565074         CDS       T04363                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04144  Endocytosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106565074
   04370 VEGF signaling pathway
    106565074
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106565074
   04137 Mitophagy - animal
    106565074
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106565074
   04520 Adherens junction
    106565074
   04530 Tight junction
    106565074
   04540 Gap junction
    106565074
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106565074
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106565074
  09152 Endocrine system
   04912 GnRH signaling pathway
    106565074
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106565074
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106565074
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  SRC family
   106565074
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106565074
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    106565074
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    106565074
  Macropinocytosis
   Kinases
    106565074
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 106565074
NCBI-ProteinID: XP_013987179
UniProt: A0A1S3L9M7
LinkDB
Position
ssa12
AA seq 588 aa
MMTTSVVANFDQDRHFRSLQLYTVLLCISVFIYGWCSPGLLMGAGKSKPKEPGQRSLSLD
GTIGTGLDSMHHHLSPAQQTQTPNRSPAVGGTRSGHHPGHAPTNTPELALFGGVDHTGSI
ISPHRGPLAGGVTTFVALYDYESRTASDLTFKKGERLQIVNNTRKYSFREGDWWLARSLT
TGESGYIPSNYVAPSDSIQAEEWYFGKLTRRNSERLLLSLQNRRGTFLVRESETTKGAYC
LSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVFHYRKHADGLCHCLTEVC
PVLKPQTQGLARDAWEIPRESLHLDLKLGQGCFGEVWMGKWNGTTRVAIKTLKTGTMSPE
AFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMTQGSLLDFLKGDTGKLLRLPQLVD
MASQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIEDNEYTARQGAKFP
IKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMMNREVLEQVERGYRMPCPG
ECPSSMHELMLTCWRKDAEERPTFEYLQGFLEDDFTSTEPQYQPGENL
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgatgacgacaagtgtggttgccaacttcgaccaagaccgacatttccgttcattgcag
ttatacactgtcttattgtgtatatctgtatttatttatggttggtgttcaccaggcctg
ctgatgggagcgggcaagagcaagcctaaggagccgggtcagcgctcactgagtctggat
ggaaccattggaacaggcttggacagcatgcaccaccacctcagcccagcccagcagacc
cagaccccgaacagaagtcccgccgtagggggcacgaggagcggccaccaccccgggcat
gcccccaccaacacccctgagctggcactgttcggcggggtggaccacacgggcagcatc
atctctcctcacagaggaccactggcaggaggtgtcactacatttgtggcgctctacgac
tatgagtcacggactgcctcggacctgacgttcaagaaaggcgagcggctgcagatcgtc
aacaacacgagaaagtacagcttcagggaaggggactggtggctcgctcggtctctgacc
accggagaaagcggttatatccccagcaactatgtggccccctcagactccatccaggca
gaagagtggtattttgggaagttaactcggcgcaactcggagaggctccttctgagttta
cagaaccgacgaggaaccttcctggtccgagagagcgaaaccactaaaggagcctattgc
ctgtccgtgttggactatgacaacactaaaggtctcaacgtcaaacactacaagatacgc
aagctagacagcggcggtttctatatcacctcacgcacccagttcagcagtctgcagcag
ctggtcttccactatcgcaagcatgcagacgggctgtgccactgtctgacggaggtgtgt
cccgtgctgaagcctcagacccagggcctggcccgcgatgcctgggaaatcccacgggaa
tcgctccacctcgacctcaaactgggccagggctgttttggagaggtctggatggggaag
tggaacggtacaacgcgggtggccatcaagaccctgaagacaggcaccatgtccccagag
gccttcctccaggaggcgcaggtcatgaagaagctgagacacgagaaactggtgcagctc
tacgctgtggtgtctgaggaacccatctacatcgtcactgagtacatgacccaaggtagc
ctgttggacttcctcaaaggtgacacgggcaagctgctacgtctaccccagctagtggat
atggcatctcagattgcagcagggatggcatacgtagagaggatgaactacgtccacaga
gacctcagggctgccaacatcctcgtaggagacaacctggtgtgtaaagtggccgacttt
ggcctggcccgcctcatagaggacaacgagtacactgccagacagggagccaagtttcct
attaagtggacggcgccagaggctgccctctacggccgcttcaccatcaagtcagatgtt
tggtcatttggggtcctgctcactgaactcgccaccaaaggcagagtgccatatccaggc
atgatgaaccgggaggtactggagcaggtggagcgcggataccgaatgccctgtcccgga
gagtgcccgagctcaatgcacgagctcatgctcacctgctggaggaaggatgccgaggag
cggcccactttcgagtacctccagggcttcctggaagatgactttacctccaccgagccc
cagtaccagcctggggagaacctatag

KEGG   Salmo salar (Atlantic salmon): 106567112
Entry
106567112         CDS       T04363                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04144  Endocytosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106567112
   04370 VEGF signaling pathway
    106567112
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106567112
   04137 Mitophagy - animal
    106567112
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106567112
   04520 Adherens junction
    106567112
   04530 Tight junction
    106567112
   04540 Gap junction
    106567112
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106567112
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106567112
  09152 Endocrine system
   04912 GnRH signaling pathway
    106567112
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106567112
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106567112
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  SRC family
   106567112
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106567112
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    106567112
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    106567112
  Macropinocytosis
   Kinases
    106567112
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 106567112
NCBI-ProteinID: XP_013991496
UniProt: A0A1S3LKR6
LinkDB
Position
ssa13
AA seq 553 aa
MGGSKSKPKDAGLRTRSLDGNISLGGGGGGYNISPAQHTLTPNLSPAVGGTRRSTQPLIN
TPELALFGGVESANSVTSPNRGTLAGGVTTFVALYDYESRTASDLSFRKGERLQIVNNMR
KLNSREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEDHLRLPMASRWYFGKITRRDSER
LLLSLDNRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQF
NNIQQLVTHYHKHADGLCHCLTEVCPVLKPQTQGLARDAWEIPRDSLCLDLKLGQGCFGE
VWMGTWNGTTRVAVKTLKTGTMSPEAFLMEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEY
MGQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVC
KVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGR
VPYPGMVNREVLDQVERGYRMPCPAECPDSLHDLMLTCWRKDAEERPTFEYLQGFLEDYF
TSTEPQYQPGENL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggggggaagcaagagcaagcccaaagacgcaggccttcggacacggagtcttgatggt
aacatcagtttaggaggagggggtggcggctacaacatcagccccgcccagcacaccctc
acgcccaatctgagtccagcagtgggcggaacacgccggtccactcagccgttgattaat
accccagagctggccctgtttgggggagtggagtccgccaatagcgtcacgtctcctaac
agagggacacttgcaggaggtgtgacgacgttcgtggcgctgtatgactacgagtctcgc
actgcctccgatctgtctttcaggaagggggaacggctacaaatagtaaacaacatgaga
aagttgaacagcagagaaggggactggtggctggctcgctctctgaccactggagaaagt
ggttacatccccagcaattatgtggctccttccgactccatccaggcagaagatcatctc
agattgcctatggcttccaggtggtattttgggaagatcacacgtcgcgactcggagagg
ctcctcttgagtttggacaacaggagagggacgttcctggtgagagagagcgagaccacc
aaaggtgcctactgtctgtcagtcctggactatgacaacactaaagggctgaatgtgaaa
cactacaagattagaaagctggacagtggagggttctacatcacctcacgcactcagttt
aacaacatacagcagctggtcacacactaccacaagcatgcagacggactgtgccactgt
ctgacggaggtatgtcccgtactaaagcctcagactcagggcctggcccgcgatgcctgg
gagatccccagggactccctatgcctcgacctcaaactgggacagggatgctttggagag
gtctggatgggcacgtggaacgggacaacgcgggtagcggtcaagaccctgaagacaggt
accatgtcccccgaggcattccttatggaggcccaggtcatgaagaagctgagacatgaa
aaactggtccagctgtacgccgtggtgtctgaagaacctatctatattgtcacggagtac
atgggacaaggaagcttattggacttcctgaagggagacatgggcaagatgctccgcctt
cctcagctggtagacatggcctcacagattgcctcaggaatggcgtatgtagagaggatg
aactacgtccacagagacctcagggctgccaacattctagtgggagacaacttggtttgt
aaagtggctgacttcggactggcccgtctcatagaggacaatgagtacactgccaggcag
ggagcaaagttccccatcaagtggacggctcctgaagctgcattgtatggccgcttcacc
atcaaatcagacgtctggtcgttcggggtcttactgacagaactggccaccaaggggaga
gtaccatatccaggcatggtgaatcgggaggtgctggaccaggtggaacgtggttacagg
atgccttgtcctgctgagtgccctgactccctccatgacctcatgctcacctgctggagg
aaggacgctgaggagaggcccacattcgagtacctgcagggcttcctggaagactacttt
acctccactgagccccagtaccagcccggggagaacctttag

KEGG   Salmo salar (Atlantic salmon): 106572626
Entry
106572626         CDS       T04363                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04144  Endocytosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106572626
   04370 VEGF signaling pathway
    106572626
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106572626
   04137 Mitophagy - animal
    106572626
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106572626
   04520 Adherens junction
    106572626
   04530 Tight junction
    106572626
   04540 Gap junction
    106572626
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106572626
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106572626
  09152 Endocrine system
   04912 GnRH signaling pathway
    106572626
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106572626
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106572626
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  SRC family
   106572626
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106572626
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    106572626
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    106572626
  Macropinocytosis
   Kinases
    106572626
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 zf-RING_14
Other DBs
NCBI-GeneID: 106572626
NCBI-ProteinID: XP_014002450
UniProt: A0A1S3MH86
LinkDB
Position
ssa15
AA seq 540 aa
MGGTKSKPKDISSGGGAGSLNFSPAQHTLNRNPAVDGARQPTQPLTNTPELALFGGAEST
SSVTSPNRGTLAGGVTTFVALYDYESRTASDLSFRKGERLQIVNNTRKLNSREGDWWLAR
SLTTGESGYIPSNYVAPSDSIQAEDHLRLPMASRWYFGKITRRDSERLLLGLENRKGTFL
VRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFNNLQQLVAHYHKH
ADGLCHCLTEVCPVLKPQTQGLARDAWEIPRDSLRLDLKLGQGCFGEVWMGTWNGTTRVA
IKTLKTGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMGQGSLLDFLKGD
MGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNMVCKVADFGLARLIED
NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLD
QVERGYRMPCPAECPESLHDLMLTCWRKDAEERPTFEYLQGFLEDYFTSTEPQYQPGENL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atggggggaaccaaaagcaagcccaaagacatcagctcgggaggaggggctggcagcctc
aacttcagccctgcccagcacaccctcaatcggaaccctgcagtggacggggcacgccag
cccactcagcccctgaccaataccccggagctggccctgtttgggggtgcggagtccacc
agtagcgtcacgtctcctaacagagggacactcgcaggaggagtgacgacgttcgtggcg
ctgtatgactacgagtctcgcactgcctccgatctgtctttcaggaagggcgagcggcta
cagatagtaaacaacacgagaaagttgaacagcagagaaggggactggtggctggctcga
tctctgactacgggagaaagcggttacatcccgagcaattatgtggctccctccgactcc
atccaggcagaagatcatctcagattgcctatggcttccaggtggtattttgggaagatc
acacgtcgcgattcggagcggctcctgttgggtttggagaacaggaaaggaacgttcttg
gtgagagagagcgagaccaccaaaggtgcctactgtctgtcagtcttggactatgacaac
actaaagggctgaacgtgaaacattacaagatcaggaagctggacagtggagggttctac
atcacctcacgcactcagtttaacaacctacagcagcttgtcgcacactaccacaagcat
gcagacggactgtgccactgtctgacagaggtgtgtcctgtactgaagccccagacccag
ggcctagcacgcgatgcctgggagatccccagggactccctccgccttgacctcaaactg
ggacagggatgcttcggagaggtctggatgggcacgtggaatggtacgacgcgggtagca
atcaagaccctgaagacaggtaccatgtcccccgaggccttcctccaggaggctcaggtc
atgaagaagctgagacatgagaagcttgtccagctctatgctgtggtgtctgaagaaccc
atctatattgttactgagtacatgggacaagggagcttattggacttcctgaagggagac
atgggcaagatgctccgtcttcctcagctggtagacatggcctcacagattgcctcaggg
atggcgtacgtagagaggatgaactacgtccacagagacctccgggctgccaacatccta
gtgggagacaacatggtgtgtaaagtggctgatttcggcctggcccgcctcatagaagac
aacgagtacaccgccaggcagggagcaaagttccccatcaagtggacagcccctgaagct
gcgctgtatggccgcttcactatcaagtctgacgtctggtccttcggggtcttgctgact
gagctggccactaaaggcagagtgccatatccaggcatggtgaatcgggaggtgttggac
caggttgagcgtggttacaggatgccctgtccagctgagtgccctgagtccctccacgac
ctcatgttgacctgctggaggaaggacgccgaggagcggcccacctttgagtacctgcag
ggcttcctggaagactacttcacctccactgagccccagtaccagcctggagagaacctg
tag

KEGG   Salmo salar (Atlantic salmon): 106583686
Entry
106583686         CDS       T04363                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src-like
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04144  Endocytosis
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106583686
   04370 VEGF signaling pathway
    106583686
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106583686
   04137 Mitophagy - animal
    106583686
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106583686
   04520 Adherens junction
    106583686
   04530 Tight junction
    106583686
   04540 Gap junction
    106583686
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106583686
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106583686
  09152 Endocrine system
   04912 GnRH signaling pathway
    106583686
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106583686
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106583686
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  SRC family
   106583686
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106583686
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    106583686
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    106583686
  Macropinocytosis
   Kinases
    106583686
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9
Other DBs
NCBI-GeneID: 106583686
NCBI-ProteinID: XP_014023654
UniProt: A0A1S3P7W1
LinkDB
Position
ssa22
AA seq 548 aa
MGAGKSKPKEPGQRSLSLDGTIGTGSDSGHHHHLNSTQQTQTPNRSPAVGGARHGHHPGH
APTNTPELALFGGVNHMGSITSPHRGPLAGGVTTFVALYDYESRTASDLTFKKGERLQII
NNTRKYSFREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLSL
QNRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQ
LVYHYHKHADGLCHCLTEVCPVLKPQTQGLARDAWEISRESLHLDLKLGQGCFGEVWMGT
WNGTTRVAIKTLKTGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGS
LLDFLKGDTGKLLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLACKVADF
GLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPG
MVNREVLDQVERGYRMPCPAECPASMHELMLTCWRKDAEERPTFEYLQGFLEDYFTSTEP
QYQPGENL
NT seq 1647 nt   +upstreamnt  +downstreamnt
atgggggcaggcaagagcaagcccaaggagccgggccagcgctcactgagtctcgatggc
accattggcacgggctcggacagtgggcaccaccaccacctcaactcgacccagcagacc
cagacccccaacaggagtcccgccgtagggggagccaggcatggccaccaccccgggcat
gctcccaccaacacccccgagctggcgctgttcggtggagtgaaccacatgggcagtatc
acctcccctcacagaggaccactggcaggaggtgtcactacatttgtggcactctatgac
tatgaatcacggactgcctcggacctgaccttcaagaaaggcgagcggctgcagatcatc
aacaacacgagaaagtacagcttcagggaaggggactggtggctggctcggtctctgact
accggagaaagcggttacatccccagcaactatgtggccccctctgactccattcaagca
gaagagtggtattttgggaaaataactcggcgcgactcagagaggctccttttgagttta
cagaaccgacgaggcaccttcctggtccgagagagcgagaccaccaagggagcctactgc
ctgtccgtgttggactacgacaacaccaaaggtctcaatgtcaaacactacaagatacgc
aagctagacagcggtggtttctacatcacctcacgcacccagttcagcagcctgcagcag
ctggtctaccactatcataagcatgcagatggactgtgccactgtctgacagaggtgtgt
ccggtgctgaagcctcagacccagggcctggcccgcgacgcctgggagatatcccgggag
tccctccacctcgacctcaaactgggccagggctgcttcggagaggtctggatggggaca
tggaatggtacaacgcgggtggccatcaagaccctgaagacaggtaccatgtccccagag
gccttcctccaggaagcccaggtcatgaagaagctgagacacgagaaactggtgcagctc
tacgccgtggtgtctgaggaacccatctacatcgtcaccgagtacatgagccaaggtagc
ctgttggacttcctgaaaggtgacacgggcaagctgctacgtctaccccagttagtggat
atggcatctcagattgcagcagggatggcatacgtagagagaatgaactacgtccacaga
gacctcagggctgccaacatcctggtcggggacaacctggcatgtaaagtggccgacttc
ggcttggcccgcctcatagaggacaacgagtacactgctagacagggtgccaagttcccc
attaagtggacggcgccagaggctgcactctacggacgcttcaccatcaagtcagatgtc
tggtcattcggggtcctgctcactgaactggccactaaaggcagagtcccatatccaggc
atggtgaaccgggaggtgttggatcaggtggagcgtggctaccggatgccctgccctgct
gagtgcccagcctccatgcacgagctcatgctcacctgctggaggaaggacgcagaagag
cgccccaccttcgagtacctccagggcttcctggaagactacttcacctccaccgagccc
cagtaccagcctggggagaacctatag

DBGET integrated database retrieval system