KEGG   Salmo salar (Atlantic salmon): 106565172
Entry
106565172         CDS       T04363                                 

Gene name
RASF1
Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 106565172
NCBI-ProteinID: XP_013987484
UniProt: B5X4D4
LinkDB
Position
ssa12
AA seq 387 aa
MLTMGSEPPQAVARLFAWVNGMSKCELIELKDLSLNDRIELAPDPPASLPPAAPLTPRQV
RAPERPSHVVRLVGDSVSVEGPSWFTGQVGKGHDFQPCSYTQISWCDLCGEFIWGLYKQS
LSCANCSYTCHFQCRPFIQLDCSTDSRLLTDLTDVSEDAVETDTNVDVIEPIDWGKQVLS
VGDIQQKVKEYNAQINSNLYMVLNRDRSYTGFIRVLFKLTRPVSLPPPRKASSPQEEGQQ
EGEIKHRTSFYLPKDTAKHLHISSQTRAREVIEALLNKFTVVDNPAKFALFERSERENQI
YLRKLSDDERPLHLRLCAGPNEKVLSLVLKENETGEVNWDAFSFPELRNFLRILQREEEE
HVRQIVKRYALARDRMKEAMASITTPG
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgctaaccatgggaagtgagccgccacaagccgttgcccggctgtttgcttgggtaaat
ggcatgtccaagtgtgagctgattgagctgaaagacctcagcctgaatgatcgcattgag
ctggcaccagacccaccagcctctctgcccccagcagcgcccctgacccccaggcaggtg
agggctccggagaggcccagccacgtggtccgtctggtgggggacagtgtgagtgttgag
gggccctcgtggttcacaggtcaggttggaaagggacatgacttccagccctgcagctac
acccagattagctggtgcgatttgtgtggtgaattcatctggggcctttacaaacagagc
ctgagctgtgctaactgcagttacacctgtcacttccagtgtcggccctttatccagttg
gattgcagcaccgatagtagactcctcactgacctaacggatgtttctgaagacgccgta
gagacggacactaacgtggatgtgattgaacctattgactgggggaaacaagtgctgtct
gtcggtgacatccagcagaaggtgaaggaatataatgctcagatcaacagcaatctctac
atggtgctgaaccgagaccgatcatatactggcttcatcagggtcctttttaagctgact
cggcccgtgtcactcccaccccctcggaaggcgtcttcaccacaggaagagggacaacag
gaaggggagattaagcaccgtacatctttctacctccccaaagacacggccaaacacctg
cacataagctcccagacgcgggcacgtgaggtcatagaggccctgctcaataagttcact
gtggtggacaaccctgccaagtttgctctgtttgagcgcagtgaacgtgaaaaccagata
taccttcgtaagctgtctgatgacgagaggccgctccacctgcgtctgtgtgccggaccc
aacgagaaagtcctcagtctggtgttgaaagagaatgagacgggggaggtcaattgggat
gcattcagctttcctgagctgcgtaatttcctgcggatccttcagcgtgaggaagaggag
cacgtccggcagatagtcaagcgctacgctctggccagggataggatgaaggaggccatg
gccagcatcaccacccccggctga

DBGET integrated database retrieval system