KEGG   Salmo salar (Atlantic salmon): 106565205
Entry
106565205         CDS       T04363                                 

Definition
(RefSeq) limbin-like
  KO
K19608  ellis van creveld syndrome protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106565205
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106565205
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    106565205
SSDB
Motif
Pfam: EVC2_like
Other DBs
NCBI-GeneID: 106565205
NCBI-ProteinID: XP_013987540
UniProt: A0A1S3L9M9
LinkDB
Position
ssa12
AA seq 1399 aa
MLQVHFLVEVVTVCTIFFCFQLEYRPIFWRRLQHRPFHSYGFCNVSHHVNPCHSAILGDS
SNAHPAFCYISVLSWGTRQNSFGNGRPRDSPRPFQHDPGGNSAELSSKKMDGQPGPCGPL
AFCAEEGPLRSVAPAGPGRQSLYTSLSHLANVMHHKARRRRSSFTRYITGHTLPQIQSAA
QPSAFGLKFQKCAQVEAGTEFPLLTFFLLINNTGPPGDSNLSQLAIRDSVSGIAALQSGG
MVVEKGFQTFTIDSLPAGSQYVVTYTALIKGHKSEILDLPAFLTFSNASLNDVNMFGPMV
ANLTLRLNSTNKIYPNHYVHFAGFVGGFFLSLLLLSLGFLAMNLICARARKSSLERRKKR
GASDPEYAVCNMSETAKEEAAFEDKMVDIMVLEDPQNMYQALENLEMSSLLRATSSLESS
RVQMYKDVIAALLAVLRSQNHMSQQAEQRLLSVLHGQLMGMEGKLKEEHLARMATLAAQC
NLETREQMEAEHRREAQEKARAEVLFQHSDEQELHQCSVLLEKLHKLNQSHLQRTLLVRH
EEASAKVQRQIVEWRRVELHKIFSEELEEATRMCELEKTEARSLLHDYFAYQNKLEEVLD
VVLANQRCMLGERHAQRRFLVHSLHSLKGLISETFSRTSSQIENCFRQHRRGSDVSEEQV
ELLLDKAQKELVLVRQGLDEALNRERRAMHCGLVKKRRDLISDMLQGHKQRQKELSALSR
GGLEEDRVEVEPAQHLRCWQSLLTAQCLELGELINNLDEEAAADIRKVTMRVIHSAMAEV
KAIQPAVAQALLALGNPRGPLQQPESGSPTGASSSALSQAQERLHLEGKAAVRTLQASRD
SLHQGMEKELQEQQELRARGQVFFRSLCSSQLTLSDEELLHMKLEFQNCLSRMDHCLMLP
HALSRSKLQTALSTWRKEMEEQAEHSQPEKKTRTKGKSTEGRQRADPSELLLFQKKMEDR
IQLFEKEKEMERTVREKVLEEMRSVRDSELRNQADGLAVQMAALHYQKAERRTRVLETSR
ALLTIQSLLTEDLRASRSLGAAPIAQSILNHCLGLEEAELQLQREHAELESLESGPSKHR
PPKDPHYSDNEEEEEEEEGQRRLFHIERDSRMATILHEALYMCDQVIVLQTERLQEANAR
NQAMEDLKEQLELKRLYTNCDQDLEFAARLVRQSQVSTEVLLEALRLLLPTLPESELLSL
IDALCPKQSVIPASAEQESTVWPGGAGKSLLVRLREEMVGRNVSAHSTDKDRNQFQEKRQ
SLLERLFLNPRPEARRDVMQVLVQEKGREGVVAIPKPVATGTSQTIASEQLQDSVLISVG
GGVEVDGETVFVSTTAAAPSTSGSANDAVVLDIPTTGERVFVFRVLPEPQNTTGATNRKR
KKRNFLNLKKGSVAPTDQP
NT seq 4200 nt   +upstreamnt  +downstreamnt
atgcttcaggtacatttcctcgtggaagtagtcactgtatgcactattttcttctgtttt
caactagagtataggcctatattttggagacgtctacaacaccgcccttttcattcgtat
gggttctgtaatgtaagccatcatgtcaatccatgccattccgctatcctgggggacagc
agcaatgcacatcccgcgttctgttacatctctgtactatcatggggaactcgacagaac
tcatttggaaatggtcgacctagagactctcctagaccatttcagcatgaccctggtgga
aactcagcagagctgagctcgaagaagatggatggacaaccagggccatgtgggcccttg
gctttctgtgctgaagagggtcctcttcgttctgtggccccagccggccccgggcgccag
tccctctacacctccttaagccacctggccaacgtcatgcatcataaggcccggcgccgc
aggagcagtttcaccagatacatcactggtcacactctgcctcagattcaaagtgctgca
cagccatcagcatttggactcaaatttcagaaatgtgcccaggtggaggcaggtaccgag
ttcccccttctgacgttcttcctgctcatcaacaacactgggcctccaggggacagcaac
ctttcccagctggccatcagggactccgtctctgggatagcagccctgcagagtgggggg
atggtggtggagaaaggcttccagaccttcaccatcgactcactgccagcaggatctcag
tatgttgtgacgtatactgccctcatcaagggtcacaagagtgaaattctggacctgcct
gccttcctaaccttctccaatgcttcactgaatgacgtcaatatgtttggtccaatggtg
gctaatttgacactgaggcttaactccacgaacaagatttaccccaatcactatgtccat
tttgctgggtttgttggtggattctttctgtccttgttgctgctgtccctgggatttctg
gccatgaacctaatatgtgcccgagccaggaaaagctccctagagcgaaggaaaaagcga
ggcgcttcagaccctgagtatgcggtatgcaacatgagtgagacggccaaagaagaggca
gcattcgaggacaagatggtggacatcatggtgctggaagaccctcagaacatgtatcaa
gctctggagaacctggagatgtccagcctgctgcgagccacctccagcctggagagcagt
cgggtccagatgtacaaagatgtgatcgcagccctgctggccgtgctgcgctcccagaac
cacatgtcccagcaggccgagcagcgcctcctgagcgtgctccacggtcagctgatgggc
atggagggcaagctgaaggaggagcacttggcacgcatggcaaccctggcggcccagtgc
aacctggagacccgggagcagatggaggcggagcatcgcagagaggcccaggagaaagca
cgggcagaggtgctgtttcagcactctgatgaacaggagctccaccaatgcagtgtcctc
ctggagaagctccacaagctgaaccagagtcacctccagcgcaccctgctggtgagacac
gaggaggcctcagccaaggtccaaaggcagatagtggagtggagaagagtggagctgcac
aagatcttctcagaagagctggaggaagccaccaggatgtgcgagttggagaagaccgag
gccaggagtctcctgcatgactactttgcctatcagaataagctggaggaggtgctggat
gtggtcctggccaaccaacgttgcatgctgggagagcgccacgcccagaggaggttcctg
gtgcacagcctccacagcctgaagggcctcatctccgagaccttctccaggacctccagc
cagatagagaactgcttcaggcaacataggagggggagcgatgtgtctgaagagcaggtg
gaactgctgctagacaaggctcagaaggagctggtgctggtgaggcagggcctggacgag
gctctgaaccgggagaggagggccatgcactgtggcctggtcaagaagaggagggacctc
atctccgacatgctgcagggccacaagcagaggcagaaggagctgtcggccctgtcccga
gggggcctggaggaggacagggtggaggtggagccggcccagcacctccgctgctggcag
agcctgctgaccgcccagtgcctggagctcggggagctcatcaacaacctggacgaggag
gccgctgcagacatccgtaaggtcaccatgcgtgtgatccacagcgccatggcggaggtg
aaggccatccagcctgctgtcgcccaggctctgctggccctggggaacccccgtggcccc
ctccagcagccagaatcggggtcccccacaggggccagcagcagcgccctgtcccaggcc
caggagaggctccatctggagggcaaggcagcagtaaggaccctccaggcctccagggac
tcgctgcaccagggcatggagaaggagctgcaggagcagcaggagctgagggccagggga
caggtcttcttcaggtctctgtgctcgtcacagctcaccttatcggacgaggagctccta
cacatgaagctggagttccagaactgtctgtccaggatggaccactgcctgatgctgccc
cacgccctctcccgctccaaactgcagaccgccctgtccacctggaggaaggagatggag
gagcaggctgaacattcacagccagagaagaagacgaggactaaagggaaatccactgag
ggcagacagcgagcagacccctcagaactgctgctcttccagaagaagatggaggacagg
atacagctgtttgagaaagaaaaagaaatggagcgcactgtgagggagaaggtcctggag
gagatgcgtagcgtgagggactcggagcttcggaaccaggcagacggcctggccgtgcag
atggccgccctccactaccagaaggctgagaggaggaccagggtcctggagacctccaga
gctctgctcaccatccagagcctgctcacagaagacctgcgagccagcaggagcctgggg
gcagcccccatagcccagagcatcctgaaccactgtctgggattggaggaagcggagctc
cagctccagagagagcatgcagagttggagagtctggagtctggaccctccaaacacaga
ccacccaaagacccacactactctgataatgaagaggaagaggaggaagaggaagggcaa
aggaggctgtttcatatagagcgtgacagccgcatggccaccatccttcacgaggccctg
tacatgtgtgatcaggtcatcgttctgcagacagagaggctgcaagaggccaacgctagg
aatcaagccatggaggatctcaaggagcagctggagctgaagagactctacacaaactgt
gaccaggatctggagtttgcggccaggttggtgaggcagagccaggtctccactgaggtt
ctcctagaggctctccgcctcctcctcccaaccctccccgagtcggagctgctctccctc
attgatgccctctgccccaagcaatcggtcatcccagcgtccgcagagcaggagagcaca
gtgtggccagggggagcaggaaaatctctgctggtcagactgagggaggaaatggtgggg
aggaatgtctcagcccacagcacggacaaggacagaaaccagttccaggagaagagacag
agcctgctggagaggctgtttctcaatcccagacccgaggctcgcagggacgtcatgcaa
gtgttggtccaggaaaaggggagggagggagttgttgccattcccaaaccagtcgcgact
ggaacgagccaaaccatagcctcggaacagctccaagactccgttctgatttcagtggga
ggaggagtagaggtggacggtgaaactgtgtttgtctccactactgcagcagcaccctcc
acctctggctcggccaacgatgcagtagtactggacatccccactacgggggagagagtg
tttgtgttccgcgttctgccggagccccagaacacgacaggggccaccaacaggaagagg
aagaaaaggaactttcttaatctgaagaagggatcggtggcccccacagaccaaccctga

KEGG   Salmo salar (Atlantic salmon): 106565206
Entry
106565206         CDS       T04363                                 

Definition
(RefSeq) ellis-van Creveld syndrome protein-like
  KO
K19605  ellis van creveld syndrome protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106565206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106565206
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    106565206
SSDB
Motif
Pfam: Phage_rep_O Polyoma_coat2
Other DBs
NCBI-GeneID: 106565206
NCBI-ProteinID: XP_013987543
UniProt: A0A1S3L9A0
LinkDB
Position
ssa12
AA seq 956 aa
MNDHDTIRHPDCSNDVLVHFAESLHIFTGLLTVATICGFFSGIIAAAVLYVFCLKPMLLT
RQGYDARRLFEGDDQDRDNNHSDCVSNSKKGVQSATTNEKEKKQPPVNSDVAAFASRAKV
VYPINQKYRPLADGASNPSLHEHSKLPVLPNGESSSGCSGDSLSQDQDNDDSSQFISSSL
VPKSLQNESFTRVALYPHTLSQTGFEGRISLYCLALQDVQIHCSQVLEEKCVLFLQILRI
ILSGRFPKDKKDSDFFTNVLLLQEKELGLLKKELSVSLFSCERNKDLGSDPCTLEEIERT
QKDLLQHALQMTKGFSKQVEAFCQSLLGRSSVLPRDEAQDVIHTLIQCLLLVENQLTETQ
AADMKRTQEKLLWWEELRGVLQAKPALLQQEVSLRQDLVARGLEQLTSDGHLTFATMEKT
LAELQTALTEGLQHCSEECRIKTKEIVYEKCKKIDSKKNKLLRTHAKERSRVLDSAQTHS
DLQEFVKVYQELLLKQRKQSSDLELQQDGRVAEAVCDLWRRHHATWSKKLGELAKDIFLS
ALPAQPQLSTNQGQRLWLDLDGDLVALLQQAESNTKRQLEGVQAQLEKDGQVWCEEAALV
LACLRHLGEQQLKILRGMVVRQSYVLNSHVGMLIEKKQHLLLVAVQRHFVARHFCLRVLK
EMRLSKLKVLSQSDFRALLALEDHTQTTVRPTLPKAQHQESSASVAERHLGPETLLIGHS
FQQEFLSELETGAELLQANAQQLVGHALSQSLWQQMDQAPPARPQPDHGRKSQLTEVVSE
SVYVTRDSLSALVTSYYSQIQDITKGLQQQHPNKAREECERRESSSQMNKAMLKELANWG
RKPMSTEFHQRVELQKKRMLEQYDLEQEVACETLRRRKLAQEQTMERIKAQLQEAEEAFI
AKLAALARIPLPGKELNTEDDFIGEEESPTLNPSLWKRRERREHETLLTNPTLLFS
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgaacgaccacgatacgattaggcatcctgattgctcaaatgatgtcttggttcacttt
gcagaatctctgcacatatttacagggttattgacagtggccactatatgtgggtttttt
tctggaatcatagctgcagccgttctgtatgtgttttgcctgaagcctatgcttctaact
cgacaaggctatgatgccagaagactgtttgagggagacgaccaggatagggacaacaac
cacagtgactgtgtcagcaacagcaagaagggtgtccaaagtgccactaccaatgaaaaa
gaaaagaagcagccacctgtgaacagcgatgtggctgcatttgcatcacgggcaaaggtg
gtgtaccccatcaaccagaaatacagacctttagcggatggagcctccaacccctcactg
cacgagcactccaagctgcctgtcctccccaatggagagtcctcgtcgggctgtagcggg
gattcactgagccaggaccaggacaacgacgacagcagccagttcatctcctcctcactg
gtccccaagagtctgcagaacgagagcttcaccagggtggccctctacccccacacgctc
tctcaaacaggttttgagggcaggatcagcctgtattgtctggccctgcaggacgtgcag
atacattgttcacaagtcctggaagagaaatgtgtgctctttctccaaattctcagaatt
atactcagcggtcgttttcccaaggataaaaaggattcagattttttcaccaatgttctt
ctcctgcaagaaaaggaactgggtttattaaagaaagaactgtcagtcagcctgttttcc
tgtgagagaaacaaagacctaggttcagatccttgtaccctggaggagattgaaagaact
cagaaagatctactgcagcacgcgcttcaaatgaccaagggctttagcaagcaggtggag
gccttctgccaaagtctcctgggcaggtccagtgttctccccagagatgaggcccaggat
gtcatccacacccttatccaatgtctcctattggtcgaaaaccagctaactgagactcag
gcggcagacatgaagaggacccaggagaagctgctgtggtgggaggagctgaggggtgta
ctgcaggccaagccagccctgctccagcaggaggtgtccctcagacaggacctggttgcc
cgaggcctggagcagctgaccagtgatggccacctgaccttcgccaccatggagaagacc
ctggccgagctgcagactgccctgaccgaggggctgcagcactgcagcgaagaatgcagg
ataaagaccaaggagattgtatatgaaaagtgcaagaagatcgactccaagaaaaataaa
ctcctgaggactcacgcaaaggagagaagccgtgtcctggattctgcacagacgcacagc
gacctgcaggaatttgtgaaggtgtatcaggagctgcttctgaagcagaggaagcagagc
agtgacttggagctgcagcaggatgggagagtggcagaggcagtgtgtgatctttggagg
aggcatcatgccacctggtccaagaagctgggagagctggccaaagacatcttcctatct
gctctccctgctcagccccagttgtccacaaaccaaggccagaggctatggctggatcta
gatggtgacctggttgcactgctgcagcaggcagagtccaataccaaacggcaactggag
ggtgtacaggctcaattggagaaagatggacaggtatggtgtgaggaagcggccctggtg
ctggcctgcctcagacacctaggtgaacagcagctgaagatccttagaggcatggtggtc
agacagagctacgtgcttaacagccatgtggggatgttgattgagaagaaacagcacctc
ctgctggtggcggtgcagaggcactttgtggccagacacttctgtctgagggtcttgaag
gaaatgaggttgtccaagctcaaggtgctgtctcagagtgacttcagggccctgctggct
ctagaggaccacacccagaccacagtcaggccaacgctccccaaagcccagcatcaggaa
tccagtgccagtgttgccgagaggcatctgggcccggagacactgctgattggccacagc
ttccagcaggagttcctgtcggagctagagacgggagcggagctcctgcaggccaatgcc
cagcagctggtgggccacgccctcagccagagcctctggcagcagatggaccaggcccct
cccgctaggccccagcctgaccacggcaggaagagccagttgacggaggtagtgtcagag
agtgtgtacgtgacccgggattccctcagtgctctggtcaccagctactactctcagatc
caggacatcaccaagggccttcagcagcaacaccctaacaaggccagagaggagtgtgaa
cgacgagagagcagctctcagatgaacaaggccatgctaaaggagctggccaactggggg
aggaagcccatgtccaccgagttccatcagagggttgaactgcagaagaagaggatgttg
gaacagtatgacttggagcaggaggttgcgtgtgaaactctgaggagaaggaagttagcc
caggaacaaaccatggagcgaatcaaagcacagttacaggaggcagaagaggccttcata
gctaaactagctgccttagctcggattccattacccggcaaagagctcaacactgaggat
gacttcataggggaggaggagagtccaacattgaatccatcattgtggaagaggcgagag
aggcgggagcatgaaactctgctcaccaatccaacacttttattttcatga

DBGET integrated database retrieval system