KEGG   Salmo salar (Atlantic salmon): 106565349
Entry
106565349         CDS       T04363                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106565349
   04012 ErbB signaling pathway
    106565349
SSDB
Motif
Pfam: DUF4840 Laminin_EGF EGF
Other DBs
NCBI-GeneID: 106565349
NCBI-ProteinID: XP_013987825
UniProt: A0A1S3LAG9
LinkDB
Position
ssa12
AA seq 193 aa
MMNRAFWDVIFLITGSLFTYGTGQDNSTIATNSTTTTTPPVTTTTVNIMIFSTTTSTITT
TNLPVKKFVAAAVRSHFDDCPDSHSHFCFHGTCRFLILEETPACVCHQGFVGMRCEHADL
LAVVATNHRQQTVATALVLCVIGCVLTMLLCTLLHCWWRQDGLGRRHRLHCAPEKPGSRL
KGRGPCCHSESVV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgaatcgggcattctgggatgtgatctttctcattactgggtccctctttacctat
ggaaccggacaggataattctactattgctactaattctactacgaccaccacccctcct
gtgactactaccactgtaaacattatgatattttctaccactaccagcaccattactaca
accaacctcccagttaaaaagtttgtggcagcagctgttcgatcacacttcgatgactgt
cctgactcgcacagccacttctgtttccatggcacctgtcgtttcctgattctggaggag
acgcctgcatgtgtgtgtcaccaaggctttgtagggatgcgatgcgagcacgccgacctg
ctagccgtggtggccaccaatcacaggcaacagacagttgccacggcgctagtgctgtgt
gtgattggctgtgtcttgacgatgctgctctgtacacttttacattgctggtggaggcag
gacggtttggggcggaggcacagactccactgtgccccagagaaaccaggcagtaggctg
aagggccgaggtccctgctgtcactctgaaagtgtggtttga

DBGET integrated database retrieval system