KEGG   Salmo salar (Atlantic salmon): 106565657
Entry
106565657         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106565657
   04068 FoxO signaling pathway
    106565657
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106565657
   04115 p53 signaling pathway
    106565657
   04218 Cellular senescence
    106565657
SSDB
Motif
Pfam: CDI DUF2576
Other DBs
NCBI-GeneID: 106565657
NCBI-ProteinID: XP_013988472
UniProt: A0A1S3LBY1
LinkDB
Position
ssa12
AA seq 163 aa
MASRKRILSSPEKSPARQNLFGPVDREQLQQEYQDTLRRDLEDTCRRWGFDFLSDKPLAG
GDFQWEEVLGTKVPLFYLPCLLGQGDAQKIGGLAASTGRVRAGPWHRGKENIPCTPEKYG
ANLQNLEKPQDKNENKLKRKQTNLTDFYQAKKRVVGTSLKSGR
NT seq 492 nt   +upstreamnt  +downstreamnt
atggccagtcgtaagcgcatcctgagctctccggagaaaagtcctgccaggcagaacctg
tttggcccagttgaccgtgagcagctgcagcaggagtaccaggacaccctgcgcagagac
ctggaggacacctgtcgccgctggggcttcgacttcctgtcagataagcctctggctggg
ggagacttccagtgggaggaggttctgggcaccaaggtgcctctcttctacctgccctgc
ctgttgggtcagggggatgcacagaagattggagggctggcagcatccacagggagggtc
agggcggggccatggcaccgtggaaaggaaaacatcccttgcacccctgagaagtacgga
gccaacctccagaacctggagaaaccgcaagacaagaatgagaacaaactgaagaggaaa
cagaccaacctcacagatttctaccaagccaagaagagagtggtgggtacgtcgcttaag
tcaggccggtga

DBGET integrated database retrieval system