KEGG   Salmo salar (Atlantic salmon): 106565980
Entry
106565980         CDS       T04363                                 

Gene name
rassf1, RASF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2 Adeno_E4_34 DUF5111
Other DBs
NCBI-GeneID: 106565980
NCBI-ProteinID: XP_013989182
UniProt: C0HBH5
LinkDB
Position
ssa12
AA seq 376 aa
MSWGEFIELRELRLHDNDRIELTSCEVPRSPPRLERANALRISPGKVPELLSRVGIIRLL
GDSLDPRLTDERGEGHDFQPCSHAQPTWCDLCGDFIWGLYKQSLRCANCGFTCHYRCRPL
IQLDCSLDRGSTVEQTCAVETDTNVDEQVKCGKQQELSGTEIQQKVKEYNAQINSNLFMN
PNKDGSYTGFIKVQFKLVRPVSVPPPRKGTATQDGAGKKNGGVKRCTSFYLPKDTSKHLH
ISSRTCAREVIEALLKKFTVVDNPGKFALFERTERHDQVFLRKLSDDERPLELRLYAGPN
EKALSLVLKENETGEVNWDAFSMPELKNFVRMLQREEEEHVKQILQRYALARTRMQEAQA
AASIPGGSSACGSTPG
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtcttggggtgagttcattgagctccgtgagttgaggctgcatgacaatgaccgaata
gagctgaccagctgtgaggtgcctcgctcaccacctcgcctggagcgggccaatgccctg
cggatcagcccagggaaggtccctgagctgctcagccgagtgggcatcatccgactgctg
ggggatagcctggacccacggctcacagatgagaggggagagggacatgacttccagccc
tgcagccatgcccagcccacctggtgtgacctgtgtggagacttcatctggggactgtac
aaacagagcctgcgctgtgccaattgcggattcacatgtcactatcgatgtcgacctctc
atccaattagattgcagtttggatcgtggctccacagttgaacaaacatgtgctgtagag
actgatacaaatgtggatgagcaggtcaaatgtgggaagcagcaggagctgtcaggcaca
gagatccagcagaaggtgaaggagtacaacgctcaaatcaacagcaacctctttatgaac
ccgaacaaagatggctcctacactggcttcataaaggtccagttcaagctggtacgacct
gtgtcagttcccccaccaagaaagggtactgcaacacaggatggtgcgggcaagaagaat
gggggagtaaaacgttgcacctctttctacctgcccaaggatacatccaaacacctacac
atcagctcccggacatgcgctcgtgaggtcatcgaagccttgctaaagaagttcactgtg
gtggacaaccctggaaagtttgccctgtttgagcgcaccgagcgtcatgaccaagtgttc
ctgcgtaagctgtctgatgacgagcgtccactcgaactgcgtctgtacgctggacccaat
gagaaagccctcagtttggtattgaaagagaatgagactggagaggtcaactgggatgcc
ttctctatgccagagctcaagaactttgtccgcatgttacagcgtgaggaggaggagcat
gtcaagcagattttgcagcgctatgctctggcccgcaccagaatgcaggaggcccaagct
gctgcttccatccctggtggttcctccgcttgtggttccacccctggctga

DBGET integrated database retrieval system