KEGG   Salmo salar (Atlantic salmon): 106566129
Entry
106566129         CDS       T04363                                 

Definition
(RefSeq) zinc finger protein GLI1-like
  KO
K16797  zinc finger protein GLI1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106566129
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106566129
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106566129
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 106566129
NCBI-ProteinID: XP_013989455
UniProt: A0A1S3LF53
LinkDB
Position
ssa12
AA seq 1540 aa
MPVDMQPHQRLYHYESTPNQPPRGLTPSGRSPYSDVSSLRAPLHNGQPLDCRNMYNPMTP
NPMTPNPRTNPNSGVNPMDQYMRPPLAPPLHSMMGHRGMNQSSDGVNSSPYCQNNLMSSH
YGFPHGHGSDHMGGGSRFSTPRSMLKLSKKRALSISPLSDASMDLHTVIRTSPNSLVAFV
NSRCGPNGGSSYGHLSVGAMSPSMGLSNSMNYQSRQQGSMYGGHTPGPCHAPPTRIPPHN
PRLHTPKHGHLKTEPGLGSVMDGISIKCLDERSEGDLASPSSNGTQDPLLGLLDCREDLD
REEKPEPEVIYETNCHWESCSKEFDTQEQLVHHINNEHIHGEKKEFVCHWQECSREQRPF
KAQYMLVVHMRRHTGEKPHKCTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAF
SNASDRAKHQNRTHSNEKPYVCKISGCTKRYTDPSSLRKHVKTVHGPEAHITKKHRGDTG
PRPPGSSLTSGGQRGELLLEKEETGHREDCKLLAPESTLKSQPSPGGQSSCSSERSPLGS
ANNNDSGVEMNLNAAGSLEDLTALEDGGAGGGCEAGGSGAGMGGMSAHALKRLENLKIEK
LKQIRRPTPPGRCGGGNKLPALTGEMMGGMCSPSALLSNRRVMELSNHELGGGSSGMVCP
ISDRRGSGTSSMSSAYTVSRRSSMVSPYLSSRRSSDVSQLGGGAGFLGSDQGGGDPVPPE
TSCRGGPCRGVGGAGGGLPEMSSLTPAQQYSLKAKYAAATGGPPPTPLPSMEQGPGTARR
RGGFLSEYQGQPLPAFLQYGGPRRQSANTGEYGTGVIYPHQAPGNATRRSSDPVRSTGNP
HALPKVQRFNSLNNLAMMGRRNALQHCGSDANITRHMLSPRPPSITENVMMEAMAMDAHG
GTVDARDHGMMLPPGERGFLGYQNHHMGGPSSQLSPSHDSLGCPEQGYQRATETSMQGVH
YQGTTRGPGQGQMGQGGPIHPEVMSSTLLQQAEYSMSTCQLSPSEPHYPHLGQAGPDGGA
GPWEESSQVQTPHGTLQTGMQYQDQGSMQGQAQTQGLYSSQQSLYTQGPDGGHQNLNIKP
EQQQYHPALANPDACQKQLHQHQQQQRPHPGQTPMPMGPMSPQSYPQQGQPGQGMMRTTN
PSCNFHGGGMENQNQASMQQGQQQIGGLIVGSAGLGPGGRSQTPMMHVKEMMVRNYVQSQ
QALLWGQEQDQSGIAAEGKPLPLSDSMDMTGQQVAMMQQQQPSPQHHQHQPQQQHQQNLY
PNPDSSFPGYSTNQNLMIPPGHSRGGPGSGSSIPPNEVPMMSLPGRPGSCYSQEMGVPVV
PRPPQGRKPLIRQNSLQSLPGGGYLGSPPHLSPVQSTSSPRRAVRLPPVQGPQTHQEIFS
PSNNSNMYYSGQIHMQHLDMDKQQIQIQRITHPHQDPTQTGPCLNQHQGHLVTHMDHQRN
KSAPLGYPHESTPISNALENVDLDNAQIDFTSIIDDPDPSSFSPVNPPLHGGSSQTSSRL
TTPQTSTTLPSSVLPNMAVGDMTSMLTSLADENKYLNTLS
NT seq 4623 nt   +upstreamnt  +downstreamnt
atgccagtggacatgcagccacatcagaggctgtatcattatgagtctacacccaaccag
ccgcccagaggtcttactccatcaggaaggtcaccctacagtgatgtgtcatcgctccgc
gctccactccacaacggccagcctcttgactgcaggaacatgtacaaccctatgacccct
aaccccatgaccccaaaccccaggactaaccctaactctggggtcaaccccatggaccag
tacatgcggccccctctggcccccccactgcacagcatgatgggacaccgcggcatgaat
cagtcctccgatggtgttaacagctccccctactgtcagaacaacctcatgtcatcccac
tatggcttcccccacggacacggatcagaccacatgggaggcggttcgcggttctccacg
cctcgctccatgctgaagctgagtaagaagcgtgctctgtccatctctcctctgtcggac
gccagcatggacctccacacggtcatcaggacctctcctaactcactggtggcatttgtc
aactcacgctgtggacccaatggaggctcctcctacggacatctgtctgttggtgccatg
agtccgtctatgggtctctccaactccatgaactaccagtccagacaacagggctcaatg
tacggcggacacaccccaggaccctgccacgcacctcccaccagaatacccccacacaac
cctcgactacacacacccaaacatggacacctgaagacagaacctggactgggcagtgtg
atggatgggatcagtattaaatgtctggacgagaggtccgagggagacctggccagccct
tcttccaatggcacacaggatcctctgctgggtctgctggactgccgggaggatctggat
agggaggagaaaccggagccagaggtaatctacgagacaaactgccactgggagagctgc
agcaaggagtttgacacgcaggagcagctagtgcaccacatcaacaatgagcacatccac
ggagagaagaaggagtttgtgtgccactggcaggagtgttccagggagcagagacctttc
aaagcccagtacatgctggtggttcacatgcgcaggcacacaggagagaaaccacataag
tgtacttttgagggctgtaataaggcctactctcgtctggagaacctgaagacccacctg
aggtctcatactggggagaaaccatacgtctgtgaacatgagggctgcaacaaagccttt
tccaatgcctcagacagagccaagcatcagaaccgcacacattccaacgagaagccttac
gtgtgtaagatctctgggtgtacgaagcgctacacagaccccagctctctgcggaagcac
gtgaagactgtccatggccctgaggctcacatcaccaagaagcatagaggagacactggg
ccccggcctcctggctcatcactgacctctggtggacagcgtggtgaactgctgctggag
aaagaggagactggacacagggaggactgcaaactgctggcacctgagagcactctgaag
tctcagcccagcccgggtggccagtcttcctgcagtagcgagcgctctccactggggagc
gccaacaacaacgacagcggtgtggagatgaacctgaatgcagctggcagtctggaggac
ctgaccgctctggaggacggaggggcaggaggaggctgcgaggcagggggctcaggggca
gggatggggggcatgtcagcacatgccctgaagagactagagaacctgaagatagagaag
ctgaaacagatcagaaggccaactccacccggacgctgtggtggggggaacaagctgcct
gcactcacaggggagatgatgggagggatgtgttctccctcggccctcctctccaaccgc
cgagtcatggaactgtccaatcacgagctggggggtggatcctctggcatggtctgtcct
atcagtgaccggagggggagtggcaccagcagcatgagctcggcctacacagtgagccgt
cgttcttccatggtttccccctacctctccagccggcgctccagcgacgtctcccagcta
ggaggaggagcagggttcctgggttctgaccagggaggaggtgaccccgtcccccctgag
accagctgcagaggaggaccctgccgtggtgtaggtggcgcaggaggagggttaccagaa
atgtctagtctaacgccagcccagcagtacagcctgaaggctaagtatgcagcagccact
ggcggcccaccccccactccactacccagtatggagcagggaccaggaacggcgaggaga
agaggaggcttcctcagcgagtaccagggtcagccgctgccagcgttcctgcagtatggc
ggtcccaggagacaaagtgccaacacgggagagtatggcactggggtcatctacccccac
caagccccagggaatgccacccggcgctccagtgaccccgtccgctccactggcaacccc
catgcccttcccaaggtgcaacgcttcaatagcctgaacaacctagccatgatgggccgg
aggaacgccctgcagcattgtgggtcagacgccaacatcacccgccatatgttatctccg
cggccacccagcatcaccgagaacgtcatgatggaggccatggccatggacgcacatggt
ggaaccgtggatgccagggaccatggcatgatgcttcccccaggagagagaggcttcctg
ggctaccagaaccaccacatggggggtccctccagccagttatcacccagccacgacagc
ctgggctgcccagagcagggctatcagcgagcgacagagacgtccatgcagggtgtgcac
taccagggtactaccaggggaccaggccagggccagatggggcaagggggacccatccac
ccagaggtgatgtctagcaccttgctacagcaggctgagtacagcatgagtacctgccag
ctcagcccctctgaaccacactacccccacctgggccaagcagggcccgatggaggtgca
gggccctgggaggagagcagtcaggtccagacccctcatggaaccctccagacagggatg
cagtaccaggaccagggctctatgcagggccaagcccagacacagggtctctacagcagc
cagcagagtctgtacacccaaggcccagatggaggccaccagaatctgaacatcaaacca
gagcagcagcagtatcatccagcccttgccaacccagacgcctgccaaaagcagctccac
caacaccaacaacagcagaggccccacccagggcagacacctatgcccatgggacccatg
tcccctcagagttacccccagcaggggcaacctggccaaggcatgatgaggactactaac
ccctcctgtaacttccatggtggagggatggagaaccagaaccaggcctccatgcaacag
gggcagcagcaaatcgggggcctcatcgtggggtcagctggtctggggcctgggggccgg
tctcagacaccaatgatgcatgtgaaggagatgatggtgaggaactatgtgcagtcccag
caggctctgttgtggggtcaggagcaggaccagagtgggatagcagcagagggaaaaccc
cttcctctgtcagacagcatggacatgacaggacaacaggtggccatgatgcagcagcag
cagcctagtccccagcatcaccaacaccagcctcagcaacaacaccaacaaaacctctac
cccaacccagactccagcttcccaggttattccaccaaccagaacctgatgatcccacca
ggccatagccgaggaggccccggctccggctcctccatcccacctaatgaggtccccatg
atgagcctgcctggacggccagggtcctgctacagccaggaaatgggagtccctgtggtt
cctagaccaccccagggccggaagcctctcatcaggcagaatagcctccagtccctgcca
ggaggagggtacctgggcagtcctccacacctcagcccagtccagtctacctccagccca
aggagagcagtccgactgccccctgtccagggccctcagacccatcaggagatcttctct
ccctccaacaatagcaacatgtattactcgggtcagatccacatgcagcaccttgacatg
gacaagcagcagatccaaatccaacggatcacccatcctcaccaggacccaacccagacc
gggccctgcctcaaccagcaccaggggcacctggtaacccatatggaccatcagaggaac
aagtctgccccgctgggctacccccatgagtccacccccatctccaatgctctggagaac
gtggatctggataatgcccagatagactttacctccatcattgatgacccagacccctcg
tccttcagccccgtcaacccacctctccatggaggttcatcccagacctcgtcccgtctc
accaccccacagacctccaccaccctgccctcctctgtgctccccaacatggctgtaggg
gacatgacctccatgctcacctctctggctgatgagaacaagtacctgaataccctgtct
tag

KEGG   Salmo salar (Atlantic salmon): 106574262
Entry
106574262         CDS       T04363                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106574262
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106574262
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106574262
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 106574262
NCBI-ProteinID: XP_014005516
UniProt: A0A1S3MRU3
LinkDB
Position
ssa16
AA seq 1538 aa
MSRMETTAPTTTEKKGSGLDGNGFTDLPKKLSPSAVTRAPHHVFPTFHTPIPIDMRHHEG
RYHYEPHALHALHAMHGPGLGGSPVMSDISLIRLSPHAAGTGESPFSPAHPYFNPHMEHY
LRSIHSSPTLSMISAARGLSPADLAHEHLKERGLFGLPPPPTGASPAEYYHLMTSHRNPY
GELLMQGGGAAAAHLPNYITPMEVSRFPSPRMTPRLNRKRALSISPLSDASIDLQTMIRT
SPNSLVAYINKSRSSSAASSSYGHLSVGGISPSFTFPHHINPMAYQQLLSQQRGLSVFGH
TPPLIQPPPIFSSRQSALGLSSLPPSSHNHNNGSQSKNTSGDLAVSSTVNPMITKRSKVK
TEVECPRPLSPCSPDHLGGMLDLKEDLDKDECKHEPEMVYETNCHWVGCSKEYDTQEQLV
HHINNDHIHGEKKEFVCRWDECSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCCKAYS
RLENLKTHLRSHTGEKPYVCDHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKVPGCTKRY
TDPSSLRKHVKTVHGPEAHVTKKQRSDLPPSRPVPPKENGENETGRGMEEKMDSTSRGME
DYLQVKSIKTEKSVMYQSSPGGQSSCSSEPSPLGSSTNHDSGVEMALHSGGGSMGDLTGL
DDPSGPLMESSFSGLSSGTAGIGVGLHLRQHLGTSHIHRLEHLKKEKLKTARDSCQWANH
HPAPPVQNTKLPPIPASGSLLESGNMCGGPGSFSLSELCSSKVTVLNQLDYLMERRDSTT
STVSSAYISRRSSGISPCYSSRRSSDASTFSGHRHHNISSTGSYDPISADLSRRSSDASQ
CGGGGGGGRLPSHLSLTPAQHYHLKAKYAAATGGAPPTPLPNMERMSLKTSLALYRDASQ
GDSSSGYSSFNTIVPSGVPRRCSGDMGSYNGRSMMPHEAPSNIPRRASDPVPRRPSLDPL
SPLSHQPQVQRYNSTGNMQNLHPHASQPNQALPAAERRHLALQSHQPRSDDSLQRYPYCP
RPPSISENVAMETMAGDMSGRRNSSEEEMMVLPDDVVHYITSQGGAGESDCANGYNRQAQ
CGFHGNAINLNPQQQQQFYHQRRVAVVDANMSMNPSSAPQSMRLSCALSPGHPQQSFPSS
LSKTSTMPVQWNEVSSGTVEALHNPTQHLPFGRSNSNLAMVQQKQNFVSFQKQNLNSNQH
IAQINHNLAHAAQQGRYIQQQKADSRLSCVQQQSLQQQQPANANLNEPVSLEYGFNQGLG
PSDANANQRSSCSSMAVGGTRSMLSQNSKQQQTVHTVDTQNSQLRTQVGGSQSSQVTFKD
SGVNSSRMISHQQNYNIPSQVQHPIQNGGQILIQPRPPTERKSLSRQHSGSMTIQRQNSI
GNHCSNGNNTDNNVMFYTGQIHVFEPNGNVNMQMMTSSVVDVLQCPSDSTETSMTSPGVN
NQVSSTMDSSNGTGAEEPQIDFDTMLDDGDHSSLMSGTISPSILQSLSQTSSRLTTPRNS
VTLTSLPLPAGGSNMAIGDMSSLLTALAEENKFLNMMS
NT seq 4617 nt   +upstreamnt  +downstreamnt
atgtccagaatggagaccactgcccccacgaccacagagaagaaaggctctggtctggat
ggaaacggcttcactgacctcccaaagaaactctccccttcagctgtcaccagagcccct
caccacgtattcccgacgttccacacgcccatcccgattgacatgcgtcaccatgaggga
agataccactatgaaccacacgccctacacgccctacatgccatgcatggtcctggacta
ggtggcagcccggtcatgtcagacatctctctgatccgtctgtccccccacgcggccggg
acaggggagtctcccttcagccccgctcacccgtacttcaaccctcacatggagcactac
ctccgctccattcacagcagcccaaccctgtccatgatctctgcagcccgcggactcagc
cctgcagacttggcacatgaacacttgaaagagcggggtctgtttgggttgccccctccc
cctactggagccagccctgctgagtactaccacttgatgaccagccatcgtaacccctac
ggagagctgctgatgcaggggggtggggcggcagctgcacacctgccaaactacatcacc
cccatggaagtgtcacggttccccagtcccagaatgacccccaggctgaacagaaagcga
gccctgtccatctcgcctctctcggacgccagcatcgacctgcagaccatgatccgtacc
tcgcccaactctctggtggcctacatcaacaagtcacgctccagctctgcagccagcagc
tcctacggacacctctctgttggaggcatcagtccgtcctttaccttcccccatcacatc
aaccccatggcctaccagcagctcctgtcccagcagagaggcctgagtgtgtttggccac
acccctcctctcatccagcccccacccatcttctccagtcgccagtctgccctgggtctc
tcctctctgcccccctcctcacacaaccacaacaatggctcacagtcaaagaacacatct
ggggacctggcagtgagcagtacagtcaatcccatgatcaccaagaggtcaaaggtgaag
acagaggtggagtgtccgaggccgctgtccccatgctctccggatcacctaggtgggatg
ctggacctgaaggaggacttggataaagatgaatgcaagcatgagccagagatggtgtat
gagacaaactgccactgggtgggatgctccaaggagtacgacacgcaggaacaactggtc
catcacatcaataacgaccacatccacggggagaagaaggagtttgtgtgccgctgggat
gagtgttccagggagcagaagccctttaaggcacagtacatgctagtggttcacatgagg
agacacacaggggagaagccacacaagtgtacctttgagggctgctgtaaggcctattct
cgcctggagaatctgaagacccacctgcgatctcacaccggggaaaaaccatatgtgtgt
gaccacgagggatgcaacaaagccttttctaacgcctcggacagagccaagcatcagaat
cgcacacactccaacgagaaaccctacgtgtgtaaagtccccgggtgtacgaagcgctac
acggaccccagctctctcaggaagcacgtgaagacagtccacggaccagaggcccacgtc
accaagaaacagcgcagcgacctgccgcccagcagacccgtgccacccaaagagaatgga
gagaacgagacaggccggggcatggaggagaagatggacagcacctcgagaggcatggag
gactacctgcaggttaagtcgatcaagacggagaagtctgtgatgtatcagtccagccct
ggtggtcagtcgtcatgtagcagcgagccatcgccacttggcagttccaccaaccatgac
agtggagtagagatggccctccatagcggcgggggcagcatgggggacctgactgggctg
gacgacccctcggggcccctcatggagtcctccttctctggcctctcgtctgggacagca
gggatcggggtgggcctccacctacgtcagcacctaggcaccagccacatccacagacta
gaacacctgaagaaggagaaactgaagacggcgagggactcctgccagtgggccaatcat
catccagctcctccagtccagaacaccaagctaccgcccataccagcaagcgggtccctt
ctggagagtggaaatatgtgtggtgggcctggatcgttcagcctcagtgagctgtgttcc
agtaaggtgactgtcctgaaccagctggactatctgatggagcgcagggacagcaccacc
agcaccgtctcctctgcctacatcagccgccgctcctctggcatctctccctgctactcc
agccgccgctccagcgacgcctccacgttcagtggccaccgccaccacaacatcagctcc
accggctcctacgaccccatctctgcagacctgtcccggaggtccagcgacgccagccag
tgtggaggtggcggaggagggggacggctgcccagtcacctcagcctcacccccgcccag
cactaccacctcaaggcgaaatatgcggcggctacaggcggagccccacccacaccttta
cccaacatggagaggatgagtctgaagacctccttggccctctacagggatgcttcccag
ggagactcgtcgtctggttactcctccttcaacaccattgtccccagtggggttcccagg
cgctgcagcggcgatatgggaagctataacggccgcagcatgatgccccacgaagctccg
tccaacattccccgtcgggctagcgaccccgtcccccggcggccgtccctggacccactg
tccccgctgtcccatcagcctcaggtgcagcgctacaacagcacgggcaacatgcagaac
ctccacccacacgcctcccagccgaaccaggccctgcctgcagccgagcggcgccacctg
gcgctccagagccaccagccgcgctccgacgacagcctgcagcgatacccctactgcccc
cggccgcccagcatctctgagaacgtggccatggagaccatggccggcgatatgagtggt
agacgcaacagcagcgaggaggagatgatggtacttcctgatgacgtcgttcactacatc
acctctcagggcggagctggagagtcagactgtgccaacgggtacaaccgacaagcacaa
tgtggtttccatggaaacgcaataaaccttaacccccagcaacaacagcagttttaccac
cagcgaagggtggccgtggtggacgccaatatgagtatgaacccttcgtctgcaccacaa
agcatgcgcctctcctgtgccctaagcccaggccatccgcagcagtctttcccctcctca
ctcagtaagacgagcaccatgccggtacagtggaacgaggtcagctcagggactgtggaa
gctcttcacaacccaacccaacatctgccgttcggtcgaagcaactcaaacctcgccatg
gtccaacagaaacagaactttgtctcgttccagaagcagaatcttaactccaaccaacac
attgcacagattaaccacaacctggctcatgcagcccagcaggggagatacatacagcag
cagaaggctgactccaggctgagctgtgtccagcaacagagcctacagcaacagcagccc
gctaatgctaacctcaatgaaccagtgagcctcgagtatgggtttaaccagggtctcggt
cctagcgatgctaacgctaaccagcggtcctcctgtagtagtatggcagttggtggcact
cggagtatgttgagccaaaacagtaaacaacagcagacagtgcacactgtagacacgcag
aacagccagctgaggacgcaggtaggggggagtcaatcgtctcaagtcacatttaaggat
agcggtgtgaactcttcgcggatgatctcgcatcaacagaactataatataccgtcccag
gttcagcatcccatccaaaatggaggtcaaatactcatccagccaagaccgcccacagaa
cgtaagtctctaagcagacagcattcagggtcaatgacaatccagcgacaaaactcaatt
ggcaatcactgcagcaatggcaacaacacagacaacaatgttatgttctacacaggacag
atacacgtgtttgagccaaacgggaacgtcaacatgcagatgatgacatcatcagtagtg
gacgttttacaatgtccctcagacagcactgagacctccatgacctcaccgggagtaaac
aaccaggtctccagtacgatggattcgtccaatgggacaggggcagaggagccccagatt
gactttgacaccatgctggatgacggggaccactccagcctgatgtcaggcaccatcagc
cccagtatcctccagagtctgtcccagacctcctccagactcaccaccccccggaactca
gtcaccctgacctccctgcccctccctgcagggggcagcaacatggccatcggcgatatg
agctccctgctcaccgcgcttgcagaagagaacaagttcctcaacatgatgtcataa

KEGG   Salmo salar (Atlantic salmon): 106575189
Entry
106575189         CDS       T04363                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106575189
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106575189
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106575189
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 106575189
NCBI-ProteinID: XP_014006990
UniProt: A0A1S3MV60
LinkDB
Position
ssa17
AA seq 1522 aa
MSRMETFAPTTTEKKGSGLDGNGFTDLPKKLSPSAVIRAPHHVFPTFHTPIPIDMRHHEG
RYHYEPHTLHAMHGPGLGGSPVMSDISLIRLSPHAAGTGESPFSPAHPYFNPHMEHYLRS
IHSSPTLSMISAARGLSPADLAHEHLKERGLFGLPPPPPGASPAEYYHLMASHRNPYGEL
LMQGAGAAAAHLPEYITPMDVSRFSSPRLTPRLNRKRALSISPLSDASIDLQTMIRTSPN
SLVAYINNSRSSSAASSSYGHLSVGGISPSFTFPHHINPMAYQQLLSQQRGLSVFGHTPP
LIQPPPTFSSRQSALGLSSLSPSSHNHNNGSQSKNTSGDSAVSSTVNPMITKRSKVKTEV
ECPRPLSPCSPDHLGGMLDLKEDLDKDECKHEPEMVYETNCHWEGCSKEYDTQEQLVHHI
NNDHIHGEKKEFVCRWDECSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCCKAYSRLE
NLKTHLRSHTGEKPYVCDHEGCNKAFSNASDRAKHQNRTHSNEKPYVCKVPGCTKRYTDP
SSLRKHVKTVHGPEAHVTKKQRSDLPPSRPMPPKENGENETGRGMEEKMDSTSRGTEDYL
QVTSIKTENSVMYQSSPGGQSSCSSEPSPLGSSTNHDSGVEMALHSSGGSMGDLTGLDDP
SGPLMDSSFSGLWSGTAGGGVGLHLRQHLGPSHIHRLEHLKKEKLKTVGDSCQWANHHPS
PPVQNTKLPPIPASGSLLERGNIGGGPGSFLSLSELCSSKVTVLNQLDHLMERRDSTTST
VSSAYISRRSSGISPCHYSRRSSDASTFSGHRHNNISSTGSYDPISTDLSRRSSDASQCG
GGGGGGGLPSHLSLTPAQHYHLKAKYAAATGGAPPTPLPNMERMSLKTPLALYRDASQGD
SSSGYSSFNPIAPSGVLRRCSGDMGGYNGRSMMPHEAPSNIPRRASDPVPRPPSLDPLSH
QSQVQRYNSMGNMQNLHPHASQPNQALSAAERRHLAPQSHQPRSDGSLQRYPYCPRPPSI
SENVAMETMAGDMSGSRNNSEEEMMVLPDDVVHYIACQGGSGESDCANGYNRQAQCGFHG
NTINPNPQQQQPFYHQQRMAVVDTNMNMNPSSAPQTMPLFCAHSPGHPQQSFPSLPSKTS
TMPVQWNEVSSGTVEALHNPSQQLPFGRSNPNLAMVQQKQNFVSFQNQNLNSNQHIAQII
HNLAHAAHQGRYIEQHKDDSRLSCVQQQSLQQQQPANANLNEPVSLGYGFNQGLGPSDAN
ANQRSSCSSMAVGGTLGMLSQNSKQQQTVHTVDTQNSRLRAQPGGSQSSQVTFKDSGVNS
SRMISQSYNIVSQVQHPIQNGVQILLQPRPPTEPKSLSRQHSGSMTMQRQNSIGNHCSNG
NNTDSNVMLYTGQIHVFEPNGNVNMQMMTSSVVDVLQCPSDSTETAMTSPGVSNQVSSTE
EPQIDFDTMLDDGDHSSLMSGTISPSILQSLSQTSSRLTTPQNSVTLPSLPLPAGGSNMA
IGDMSSLLTALAEENKFLNMMS
NT seq 4569 nt   +upstreamnt  +downstreamnt
atgtccagaatggagacctttgccccgacgaccacagagaagaaaggctctggtctggat
ggaaacggcttcactgacctcccaaagaaactctccccttcagctgtcatcagagcccct
caccacgtattcccgacgttccacacgcccatcccgattgacatgcgtcaccatgaggga
agataccactatgaaccacacaccctacatgccatgcatggtcctggactaggtggcagc
ccggtcatgtcagacatctctctgatccgtctgtccccccacgcagccggaacgggggag
tcccccttcagccccgctcacccctacttcaaccctcacatggagcactacctccgctcc
attcacagcagcccaaccctgtccatgatctctgcagcccgcggactcagccctgcagac
ttggcgcatgaacacttgaaagagcggggtctgtttgggttgccccctccccctcctgga
gccagccctgctgagtactaccacctgatggccagccatcgtaacccctacggagagctg
ctgatgcagggggctggggcggcagctgcacacctgccagaatacatcacccccatggat
gtgtcacggttctccagtcccagactgacccccaggctgaacagaaagcgagccctgtcc
atctctcctctctcggacgccagcatcgacctgcagaccatgatccgtacctcacccaac
tctctggtggcttacatcaacaactcacgctccagctctgcagccagcagctcctacgga
cacctctctgttggaggcatcagtccgtcctttaccttcccccaccacatcaaccccatg
gcctaccagcagctcctgtcccagcagagaggcctgagtgtgttcgggcacacccctcct
ctcatccagcccccacccaccttctccagtcgccagtctgccctgggtctctcctctctg
tccccctcctcacacaaccacaacaatggctcacagtcaaagaacacaagtggggactcg
gcagtgagcagtacagtcaatcccatgatcaccaagaggtcaaaggtgaagacagaggtg
gagtgtccgaggccgctgtccccatgttctccggatcatctaggggggatgctggacctg
aaggaggacttggataaagatgaatgcaagcatgagccagagatggtgtatgagacaaac
tgccactgggaaggatgttccaaggagtacgacacgcaggaacaactggttcatcacatc
aataacgaccacatccacggggagaagaaggagtttgtgtgccgctgggatgagtgttcc
agggagcagaagccctttaaggcacagtacatgctggtggttcacatgaggagacatacg
ggggagaagccacacaagtgtacctttgagggctgctgtaaggcctattctcgcctggag
aatctgaagacccacctgcgatctcacaccggggaaaaaccatatgtgtgtgaccacgag
ggatgcaacaaagccttctctaatgcctcggacagagccaagcaccagaaccgcacacac
tccaatgagaaaccctacgtgtgtaaagtccccgggtgtacgaagcgctacacggacccc
agctctctcaggaagcacgtgaagacagtccatggaccagaggcccacgtcacaaagaaa
cagcgcagcgacctgccgcccagcagacccatgccacccaaagagaatggagagaacgag
acaggccggggcatggaggagaagatggacagcacctcgagaggcacggaggactacctg
caggtcacgtctatcaagacggagaactctgtgatgtatcagtccagccctggtggtcag
tcgtcatgtagcagcgagccgtcgccacttggcagttccaccaaccatgacagtggagta
gagatggccctccacagcagcgggggaagcatgggggacctgactgggctggacgacccc
tcagggcccctcatggactcctccttctctggcctctggtctgggacagcagggggtggg
gtgggcctccacctacgtcagcacctaggccccagccacatccacagactagaacacctg
aagaaggagaaactgaagacggtgggggactcctgccagtgggccaatcatcatccatct
cctccagtccagaacaccaagctaccgcccataccagcaagcgggtcccttctggagaga
ggaaatattggtggtgggcctggatcgttcctcagcctcagtgagctgtgttccagtaag
gtgactgtcctgaaccagctggaccatctgatggagcgcagggacagcaccaccagcacc
gtctcctctgcctacatcagccggcgctcctctggcatctccccctgccactacagccgc
cgctccagcgacgcctccacgttcagtggccaccgccacaacaacatcagctccaccggc
tcctacgaccccatctctacagacctgtcccggaggtccagtgacgctagccagtgtgga
ggtggtggaggagggggagggctgcccagtcacctcagcctcacccccgcccagcactac
cacctcaaggctaaatatgcggcggctacaggcggagccccacccacacctctacccaac
atggagaggatgagtctgaagacccccttggccctctacagggatgcttcccagggagac
tcatcgtctggttactcctccttcaaccccattgcccccagtggtgttctcaggcgctgc
agcggcgatatgggaggctataacggccgcagcatgatgccccacgaagctccgtccaac
attccccgtcgggctagcgaccccgtcccccgaccgccatcgctggacccgctgtcccat
cagtctcaggtgcagcgctacaacagcatgggcaacatgcagaacctccacccacatgcc
tcccagcccaaccaggccctgtctgcagccgagcggcgccacctggcgccccagagccac
cagccgcgctccgacggcagtctgcagcgatacccttactgcccccggccgcccagcatc
tctgagaacgtggccatggagaccatggccggcgacatgagcggtagtcgcaacaacagt
gaggaggagatgatggtacttcctgatgacgtcgttcactacatcgcctgtcagggcgga
tctggagagtcagactgtgccaacgggtacaaccgacaagcacaatgtggtttccatgga
aacacaataaaccctaacccccagcagcaacagccgttttaccaccagcaaaggatggct
gtggtggacaccaatatgaatatgaacccctcgtctgcaccacaaaccatgcccctcttc
tgtgcccacagcccaggccatccgcagcagtctttcccctccttacccagtaagacgagc
accatgccggtgcagtggaacgaggtcagctcaggtactgtggaagctcttcacaaccca
agtcaacagctgccgttcggtcgaagcaacccaaacctcgccatggtccaacagaaacag
aactttgtctcgttccagaatcagaatcttaactccaaccaacacattgcacagattatc
cacaacctggctcacgcagcacatcaggggagatacatagagcagcataaggatgactcc
aggctgagctgtgtccagcaacagagcctacagcaacagcagcccgctaatgctaacctc
aatgaaccagtgagtctcgggtatgggtttaaccagggtcttggtcctagcgatgctaac
gctaaccagcggtcctcctgtagtagtatggcagttggtggcactctgggtatgttgagc
caaaacagtaaacaacaacagacagtgcacactgtagacacgcagaacagccggctgagg
gcgcagccaggggggagtcaatcgtctcaagtcacatttaaggatagcggtgtgaattct
tcgcggatgatctcacagagctataatatagtgtcccaggttcagcatcccatccaaaat
ggagttcaaatactcctccagccaagaccgcccacagaacctaagtctctaagcagacag
cattcagggtcaatgacaatgcagcggcaaaactcaattggcaatcactgcagcaatggc
aacaacacagacagcaatgttatgctctacacaggacagatacatgtgtttgagccaaac
ggaaatgtcaacatgcagatgatgacatcatcagtagtggacgttcttcaatgtccctca
gacagcactgagaccgccatgacctcaccgggagtaagcaaccaggtctccagtacagag
gagccccagattgactttgacaccatgctggatgacggggaccactccagcctgatgtca
ggcaccatcagccccagtatcctccagagtctgtcccagacctcctcgagactcaccacc
ccccagaactctgtcaccctgccctccctgcccctccctgcagggggcagcaacatggcc
atcggcgatatgagctccctgctcaccgcgcttgcagaagagaacaagttcctcaacatg
atgtcataa

KEGG   Salmo salar (Atlantic salmon): 106582360
Entry
106582360         CDS       T04363                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106582360
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106582360
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106582360
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC AAA_lid_2
Other DBs
NCBI-GeneID: 106582360
NCBI-ProteinID: XP_014020889
UniProt: A0A1S3NZU2
LinkDB
Position
ssa21
AA seq 1450 aa
MRHHEGRYHYEPHPLHTMHGPQGLASSPVISDGISLIRLSPQAAGTGESPFSPPHPYINH
HMEHYLRSMHSSPTLSMISAARGLSPTEVTHEHLKERGLFSLPPPPPGANPTQYYHLMAS
GRSTYGDLLLQTGAAAAAAAAAAHLPDYISPMDVSRFSSPRLTPRLNRKRALSISPLSDA
SIDLQTMIRTSPNSLVAYINNSRSSSAASSSYGHLSVSGISPSFTFPHSINPMAYQQLFN
QQRGLSAFGHTPPLIQPSPSFAARQHAHAIAASALNTTHNTSSSESNQNAGGDPAVSSTV
NPMITKRHKVKTEAVGPRSISPCSQEHVLDLSEERDKDEWKQEPEAVYETNCHWDGCTKE
YDTQDQLVHHINNDHIHGEKKEFVCHWDECSREQKPFKAQYMLVVHMRRHTGEKPHKCTF
EGCCKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICK
IPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDVPPRGPPKGNGENEANAKQSDRGID
GKMEANSITRGVEDCLQVKSIKTENSMTYQSSPGGHSSCSSEPSPLGSAHNNDSGVEMAL
HSGGSFGELSALDDPPMVDSSTLSHGNSAGVGLGLCKGGGVTIKLENIKKERLKNVRDTC
PWANSGPQIRNTNTKLPPIPAVGSLLENSNMIAPPGPYPGQRLGDLSSCEVTMLNQLNEQ
GRRYSNTSTASSAYTSRRSSGISPCYSSRRSSEASQFSNRHNNISSADSYDPISTDLSRR
SSEASQCGGNVPSLLSLTPAQHYHLKAKYAAATGGAPPTPLPNMERMSLRTRMALYGEHS
QERESSSHYNLFQPPAGAVPRRCSDIGYSNHSRMPHEVPVNLPRRASDPVRRPTLDPLSL
PRVQRYNSMNSMNPNSMMPPPSTDRRGLAMQGYTRSDGSLHRHPFAPRPPSISENVVMET
MAVDGLDHAGDEDMVLPDDVVQYLRSQNTGAGQSAGPTDYTNSQSHGFQVQGNTTSSQQQ
FYGQRRMAMVDTNMPLSESGQAPLTPYKMSPGSGSQQQQYPTSPSMNNKKNMPVQWNEVS
SGTVDATATSRLTKQNLLRNNNLAVVQQRQNCGPFQGSMGSNSNQQGMPMSQNIELQGYT
QRSNAQRINSVQQQQRQPCSINYTEQMSPQQGYGQDIVPIPNSGSGNGSLRPNYDGMALP
NGSVMATHNPDIQNYRSRTQVESYPPHMNQIEQLNYSSTPQQQAVHTGIRDGMQPRLPME
TKSMSRQHVRSSSTMQNRFLQSDFNHNTSEASPKKPGRTAAHNVGQNGNSNSNTPMLYTG
QIHMFEPSNNLSFDSPMSPCTPQAPVGTTIIMASPGVNQVTSTVDSSGVEHAQIDFDAML
DDGDHSSLMSGTLSPGLLTSLSQNSSRLTTPRNSVTLASVPAGIGNMAIGDMNSMLTALA
EESKFLNMMS
NT seq 4353 nt   +upstreamnt  +downstreamnt
atgcgtcaccatgaggggaggtaccattacgagccacaccccctccacaccatgcatgga
cctcaaggcctagccagcagcccagtcatctcagacggcatctctctgatccgtctgtcc
cctcaggcagcagggacgggggagtcccccttcagcccccctcacccctacatcaaccac
cacatggagcactacctccgctccatgcacagcagccctaccctatccatgatctcagct
gcccgtggactcagccccacagaagtgacccatgagcacctgaaggagcgtggtctgttc
agcctgccccctccccctccaggggccaatcctacacagtactaccacctcatggccagt
ggcagaagcacctacggagacctcctcttgcagaccggggcggccgcggcagcagcagcc
gcagcagcacacctgcccgactacatcagccctatggacgtgtccaggttctccagcccc
agactgacccccaggttgaacaggaagcgagctctgtccatctcccctctctcagacgcc
agcatcgacctgcagaccatgattcgtacctcgcccaactctctggtggcttacatcaac
aactcacgctccagctctgcagccagcagctcctacggacacctgtcagtcagcggcatc
agtccgtcgttcaccttcccccactccatcaaccccatggcataccagcagctgttcaac
caacagagaggcctgagtgcgtttggccatacccctcccctcatccaaccctcgccctcc
ttcgctgcccgccagcatgcccacgcaattgcagcctctgccctcaacaccacccacaac
acctccagctctgagtccaaccagaatgctggtggcgacccggcggtgagcagcacagtc
aaccccatgatcaccaagaggcacaaggtcaagacagaagcagtgggaccccggtccata
tcaccgtgctctcaggagcatgtcctggacctgagtgaggagcgggataaagatgagtgg
aagcaggagccagaggctgtctacgagaccaactgtcactgggatggctgcaccaaggag
tacgacacccaggaccagctcgttcaccacatcaacaacgaccacatccatggggagaag
aaagagtttgtgtgccattgggatgagtgctcgagagaacagaagcccttcaaagctcag
tacatgctggtggtccacatgaggagacacactggggagaagccacacaaatgcacattt
gaaggatgctgtaaggcctactctcgcctggagaacctgaagacccacctgaggtcccac
acaggggagaagccgtacgtctgtgaacatgagggctgcaacaaagccttctccaatgcc
tcagacagagccaagcaccagaaccgcacacactccaatgagaaaccctacatctgtaag
atccctgggtgcactaaacgctacacagaccccagctctctcaggaagcatgtgaagacg
gttcacggaccagaggcccacgtcacaaagaaacaacgtggcgatgtgcctcccaggggt
cctcccaagggaaatggagagaacgaggcaaatgccaaacagagtgatagagggatagat
ggaaagatggaggccaacagcattactagaggagtggaggactgcctgcaggtcaagtca
atcaagaccgagaactcgatgacgtatcaatccagccctggcggtcactcgtcatgtagc
agtgagccatcgccacttggcagtgcccacaacaatgacagtggagtagagatggccctg
cacagcgggggcagctttggggagctgagtgcactggatgaccctccgatggtggactcc
tccaccctctcccacggcaactcagcaggggtggggcttgggctctgtaaagggggagga
gtcaccatcaagctggagaacatcaagaaggagaggctgaagaatgtgagggacacgtgt
ccctgggccaactctggtccacagatccggaacaccaacaccaagctgcctcctattcct
gctgttggttcccttctggagaactccaatatgatcgctccacccgggccctaccctggt
cagcgtcttggtgacctgtcatcatgcgaggtgaccatgctaaaccagctgaatgagcag
ggccgccggtacagcaacaccagcactgccagttcagcctacaccagccgccgctcctcg
ggcatctccccctgctactccagccgccgctcttccgaagcttcgcagttcagcaaccgc
cacaacaacatcagctcagccgactcctacgaccccatctccacagacctgtcccggaga
tccagtgaggccagccagtgtggtggaaacgtccctagtttgctcagcctcaccccggct
cagcactaccatcttaaggccaagtatgctgccgcaaccgggggagctccacccacacct
ctgcccaacatggagcgcatgagcctcaggaccaggatggccctgtatggggaacactcc
caggagagggagagctcctcccattacaacctgttccagccccctgctggagcagtgccc
agacgctgcagcgacattggctacagtaaccatagtaggatgccccacgaggtccctgtg
aacctgccacggcgagccagcgatcccgtccgcagacccaccttggacccactgtccctg
ccgagggtccagcgctacaacagcatgaacagtatgaaccccaactccatgatgcctcct
ccctctactgatcgccggggcctggccatgcagggctacacacggtccgacggaagtctg
caccgccaccctttcgccccgcggccccccagcatctcagagaatgtggtgatggagacc
atggctgtggacgggctggaccatgcaggggatgaggacatggtgctgcctgatgatgtc
gttcagtatctcaggtctcagaacactggcgccggccaatcagcaggccccaccgactac
accaacagccaatcacacggcttccaggtccaagggaatacgacctcctcccagcagcag
ttctatgggcaaaggaggatggccatggtggataccaacatgcccctgtctgagtcaggc
caggcccccctaacgccatacaagatgagccctggttctggatcacagcaacagcagtac
ccaacctcacccagtatgaacaacaaaaaaaacatgccagtgcagtggaatgaggtcagc
tcagggactgtggacgccacagccacctcaagactcaccaagcagaacctcctcagaaac
aacaacctggcagtggttcagcagagacagaactgtggacctttccagggtagtatgggt
agtaacagtaaccagcaggggatgcctatgagccagaacatagagcttcaaggctacacc
cagagaagcaacgcccaaaggatcaactctgtccaacagcaacagaggcagccatgcagc
attaattatactgagcagatgagtccccagcagggatacggccaagacatcgtccccatc
cctaactctggatctgggaatggcagcctacgacccaactacgacggcatggcactgccc
aatggcagtgtaatggcaacacataatccagatattcaaaactacagatcaaggactcag
gttgaaagctatccccctcacatgaatcagattgagcagctgaactacagtagtacgcct
cagcagcaagccgtccatactgggatcagagatgggatgcagcccaggcttcccatggag
accaagtctatgtccagacaacatgtaagatccagcagtacgatgcagaaccgtttcctt
cagtctgacttcaatcacaacacctctgaggccagtccaaagaagccaggccgcaccgca
gcacataacgtcggacaaaatggaaactccaactctaacactccaatgttatacactggc
cagatacacatgttcgagcccagcaacaacctgagtttcgactcccccatgtccccctgc
acaccccaggcaccggtaggcaccaccattatcatggcatccccaggggtcaaccaggtc
accagcaccgtggactcctctggtgtggagcacgcccagattgactttgatgccatgttg
gatgatggtgaccactccagcctgatgtcggggaccctcagccccgggctcctcacaagt
ctgtcccagaactcctccaggctcaccaccccccgtaactctgtgaccctggcctccgta
ccagcagggattggtaacatggccatcggcgatatgaactccatgttgaccgcactggct
gaggagagcaagttcctcaacatgatgagctaa

KEGG   Salmo salar (Atlantic salmon): 106582669
Entry
106582669         CDS       T04363                                 

Gene name
gli1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106582669 (gli1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106582669 (gli1)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106582669 (gli1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC DnaT
Other DBs
NCBI-GeneID: 106582669
NCBI-ProteinID: XP_014021423
UniProt: A0A1S3P1B2
LinkDB
Position
ssa22
AA seq 1276 aa
MDGINIKSLEERSEGDVASPSSTGTQDPLMGLLEGREDLDKEDKPEPEAIYETNCHWESC
SKEFDTQEQLVHHINNEHIHGEKKEFVCHWQECSREQRPFKAQYMLVVHMRRHTGEKPHK
CTFEGCNKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPY
VCKIPGCTKRYTDPSSLRKHVKTVHGPEAHITKKHRGDTGPRPPGSSLTPGGQSGELLLE
KEETRHREDCKLLAPESALKSQPSPGGQSSCSSERSPLGSANNNDSGVEMNLNAAGSLED
LTALEDGGAGGGGEAGGRGQGMAGMGGTSAQALKRLENLKIDKLKQIRRPTPPGRCGRSS
KLPALTGCPGEMMGGMCTPSPLLSNRRVMELSNHELGGGPSGMPPPISDRRGSGTSSLSS
AYTVSRRSSMVSPYLSSRRSSEVSQLGGGGGGFLGPDQGGGDPLSPETSRRRGPCHGVGG
GGGLPGLPCLTPAQQYSLKAKYAAATGGPPPTPLPSMEQGAGTPGRRGVLLSEYQGQPLP
AFLQQGGQRRHSANTGEYGTGVIYPHQAPGNATRRASDPIRSTGDPQALPKVQRFNSLNN
VAMMGRRNALQHCGSDANIARHMYSPRPPRITENVLMEAMATDYHGGTMDARNHCMMLSP
GERGFLGYQSHHMGGPTSLLSPSHDSLGCPEQGYQTQGQMFMQGGHHQGTSRGPGQGQMG
QGGPIHPEGMSKILLQQAEYSMSTCQLSPSGPHYPSLDQGGPDVGTGAWIESSQVQTTHE
VLQTEMQYQDQGSMQGQTQGLYTQEPDGGHKLIIKPEQQQYHPALANPDACQKQLHQHQQ
QRPHPGQTPMPMRPMSSQSGYPQQGQPGQGMMRTTNPSCDFHGGGMENQNQASMQQGKQQ
GSFPQSGGISLGSAALGAGGRSQTPMMQVKEMMVRNYVQSQQALMWGQEQDQRGIGVDGK
PLPLSDSMDMTGQQVAMMQQQHSPQHQHNLYPNPGSSYPGYPTNQNLMSSPAHNRVPSSG
SSIPPTEVPMTGLPGGPGSCYGQDMGAPVVPRPPQCRKPLSRQNSLQSQGGGAYLGSPPH
LSPVHSTSSPRRVVRLPPVQGHMTPHQTHQEIFPPLNNINNNMYYSGQIHLQHSDMDKQQ
IQQISHPHQDPTQTGPCLNQHQHQQHMVTHMDHQGNKSASLAYLHESTPISNALENLDLD
NAQIDFTSIIDDPDPSSFSPINPPLHGGSSQTSSRLTTPQTSITMPPSGLPNMAVGDMTS
MLTSLAGENKYLNTLS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggatgggatcaacattaagagtctggaggagaggtctgagggtgacgtggccagccca
tcctctactggcacacaggatcctctgatgggtctgctggaggggcgggaggatctggat
aaggaggataaaccggaaccagaggccatctatgagaccaactgccactgggagagctgc
agcaaggagtttgacacgcaggagcagctagtccaccacataaacaacgagcacatccat
ggagagaagaaggagtttgtgtgccactggcaggagtgttccagggagcagagaccattc
aaagcccagtacatgctggtggttcacatgcgcaggcacacaggagagaaaccgcataag
tgtacttttgagggctgtaataaggcctactctcgcctggagaacctgaagacccacctg
cggtctcatacaggggagaagccgtatgtctgtgaacacgagggatgcaacaaagccttc
tccaacgcctcagacagagccaagcaccagaaccgcacacactccaacgagaagccgtat
gtgtgtaagatccctgggtgtacgaaacgctacacagaccccagctcactgcggaagcac
gttaagacagtccacggccctgaggctcacatcactaagaagcaccgaggggacactggg
ccccggccgcctggctcatcactgacccctggtggacagtctggtgaactgctgctagag
aaagaggagactagacacagggaggactgcaaactgctggcgcctgaatctgctctgaag
tctcagcccagtccgggtggccagtcatcctgcagtagcgagcgttctccgctggggagc
gcgaacaacaacgacagtggtgtggagatgaacctgaacgcagcagggagtctggaggac
ctgaccgctctggaggacggaggggcgggaggaggaggggaagctgggggaagagggcag
ggcatggcagggatggggggcacgtcggctcaggccctaaagagactagagaacctgaag
atagacaagctgaaacagatcagaaggcccactccacccggacgctgtggtaggagtagc
aaactaccagcactcacaggttgtccaggagagatgatgggagggatgtgtactccctcg
cccctcctctccaaccgccgcgtcatggaactgtccaatcacgagctgggcggcggaccc
tctggcatgcccccccctatcagtgaccggagggggagtggcaccagcagcctaagctct
gcctacacagtgagccgtcgttcttccatggtgtccccctacctctccagccggcgctcg
agcgaggtctcccagttaggaggaggtggaggagggttcctgggtcctgaccagggagga
ggtgaccccctctcccctgagaccagccgccgaagagggccctgccatggtgttggaggg
ggaggagggttgccaggtctgccttgtctaacacccgctcagcaatacagcctgaaggct
aagtatgcagcagcaactggcggcccaccccctaccccgctgcccagtatggaacaggga
gcagggacacccgggagacgaggagtgctcctcagcgagtaccagggtcagccgctacct
gcgttcctgcagcaggggggtcagaggagacacagtgccaacactggggagtatggcact
ggggtcatctacccccaccaagccccggggaatgccacccggcgtgccagcgaccccatc
cgctccaccggcgacccacaggcccttcccaaggtgcaacgcttcaacagcctgaacaat
gtggccatgatgggccggaggaacgccctgcagcattgtgggtcagacgccaacatcgcc
cgccacatgtactcgccgcggccacccagaattacagaaaatgtcctgatggaggccatg
gctacagactaccatggaggaaccatggatgccaggaaccactgcatgatgctttcccca
ggagagagaggcttcctgggctaccagtcccaccacatgggggggcccaccagcctgtta
tcacccagccacgacagcctgggatgcccggagcagggctaccagacacagggacagatg
ttcatgcagggtgggcaccaccagggcacctccagaggaccaggtcagggccagatgggg
caggggggacccattcacccagaggggatgtcaaaaatcttgctgcagcaggctgagtac
agtatgagtacctgccagcttagtccctctggaccacactaccccagcctggaccagggt
ggccccgatgtaggtacaggggcctggatagagagcagccaggtccagaccactcatgaa
gttcttcagacggagatgcagtatcaggaccagggctctatgcagggccagacacagggt
ctgtacacccaagagcccgatggcggacacaaactgatcatcaaaccagaacagcagcag
taccacccagccctagccaacccagatgcctgccagaagcaactccaccaacaccagcag
cagaggccccatccagggcagacacccatgcccatgcgacccatgtcctcccagagcggt
tacccccagcaggggcagcctggccagggcatgatgaggaccaccaaccccagctgtgac
ttccatggaggaggcatggagaaccagaaccaggcctccatgcagcaagggaagcagcag
ggttccttcccccaaagcggaggcatcagcctggggtcggctgcgctgggtgctgggggt
cgctcccagacacccatgatgcaggtgaaggagatgatggtgaggaactatgtgcagtcg
cagcaggctctgatgtggggtcaggagcaggaccagagggggataggagtggacggcaaa
cctcttcctctgtcagacagcatggacatgacaggacagcaggtggccatgatgcagcaa
cagcatagtccccaacaccaacataatctctaccccaacccaggctccagctacccaggc
taccctaccaaccagaacctgatgagctccccagcacacaaccgagtccccagctctggc
tcctccatccccccgacggaggtacccatgacgggtctgcctggaggcccagggtcctgc
tacggccaggacatgggggcccctgtagtcccaagacccccccagtgccggaagcccctc
agcaggcagaatagtctccagtcccagggaggtggagcgtacctgggcagtcctccccac
ctcagcccagtccactctacctccagccccagacgtgtggtccgtctgccccctgtccag
ggccacatgaccccccatcagacccaccaggagatcttccctcccttaaacaacatcaac
aataacatgtactactctggccagatccacttgcagcactctgacatggacaagcagcag
atccagcaaatcagccaccctcaccaggacccaactcagaccgggccctgcctcaatcag
caccagcaccaacagcacatggtaacccacatggatcaccagggcaataagtctgcgtcc
ctagcctaccttcatgagtcgacccccatctccaatgctctggagaacctagatctggac
aacgcccagatagactttacctccatcatcgatgacccagacccctcgtcattcagcccc
atcaaccctcctctccatgggggttcatcccagacctcgtcccgcctcaccacccctcag
acatccatcaccatgcccccctctgggctccctaacatggctgtaggagacatgacctcc
atgttgacatctctggccggagagaacaagtaccttaatacactgtcttag

KEGG   Salmo salar (Atlantic salmon): 106586430
Entry
106586430         CDS       T04363                                 

Definition
(RefSeq) zinc finger protein GLI2-like
  KO
K16798  zinc finger protein GLI2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106586430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106586430
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106586430
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Other DBs
NCBI-GeneID: 106586430
NCBI-ProteinID: XP_014029177
UniProt: A0A1S3PNC3
LinkDB
Position
ssa25
AA seq 1518 aa
METSAPTATEKKEHKGSGLDGSSFSDLPKKPSPTTVTRGPHHLFPTFHTPIPIDMRHHEG
RYHYEPHPLHAMHGHHGLAGSPVISDGISLIRLSPHAAGTGDSPFSPPHSYVHPQMEHYL
RSMHSSPTLSMISAARGLSPAEVTHEHLKEHGLFSLPPPPPGANPTDYYHLMASGRSTYG
DLIMQTGAAAAAAAAAAHLPDYSPVDVSRFSSPRLTPRLNRKRALSISPLSDASIDLQTM
IRTSPNSLVAYINNSRSSSAASSSYGHLSVSGISPSFTFPHPINPMAYQQLLNQQRGLSA
FGHTPPLIQPSPSFAARQHAHALAASTLNTTHNTSSSESNQNAGGDPAVSSTVNPMITKR
HKVKTEAEGPRPISPCFQEHVLDLSEELDKDECKQEPEAVYETNCHWVGCSKEYDTQDQL
VHHINNDHIHGEKKEFVCRWDECSREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCCKAY
SRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKR
YTDPSSLRKHVKTVHGPEAHVTKKQRGDVPPRGPPKGNGENEANAKQSGRGMDGKMVANS
TIRGAEDCLQVKSIKTENSITYQSSPGGHSSCSSEPSPLGSAHNNDSGVEMALHSGGSFG
DLSALDDPPMVDSSTLSPRNSVGVGLGLHKGGGVTIKLENIKKERLKNVRDSCPWANSGP
QAPQVRNTKLPPIPAVGSLLENSNMIAPPGPYPGQRLGDLSSCEVTMLNQLNEQGRRDSN
TSTASSAYISRRSSGISPCYSSRRSSEASQFSNRHNNISSADSYDPISTDLSRRSSEASQ
CGGGNLSSLLSLTPAQHYHLKAKYAAAIGGAPPTPLPNMERMSLRTRMALYGDHSQERES
LSHCQLFHPPTAAVPRRCSDIGYSSYSMMPHEVPGNLPRRASDPVRRPTLDPLSLPRVQR
YNSMNSMNPNSVMPPPSADRRGLAMQSYTRSDGSLHHHPFAPRPPSISENVVMETMAVDG
LDHAGDEDMVLPDDVIQYLRSQNTGPGQSAGPADYANSQSQGGFQVQGNMTSSQQQFYGQ
RRMAMVDANMPLSGSGQAPLPPYQMSPGSGSQQQQYPASHSMNNKNNMPVQWNEVSSGTV
DATATSRLTKQNLLRNNNLAMVQQRQNFGHFQGRMGSNSNQQVMPMNQNMALQGYTQRSN
SQWINSVQQQQRQPCSMNYPEQMSPQQGYGQEIIPVPNSGSGNGSLRPNFNGMALPNSRV
MATHNNPDTQIYRSRTQVESYVPHMIQVDQQNYSISSQQQDVNTGNRVGMQPRPPMEPKS
MSSRQHSGSRSMMQQNRFPQSDLHHNTNEASPKRPGGTAAHTGGHNRDSNSNASMFYAGQ
IQMFEPNNNHNVSFNSPMSPFMGQTPGGTTVTMASPGVNQVTSTVDSSGSSGSISGVEHA
QIDFDAMLDDGDHSSLMSGTLSPGLLTSLSQNSSRLTTPRNSVTLASVPAGIGNMAIGDM
SSMLTTLAEESKFLNMMS
NT seq 4557 nt   +upstreamnt  +downstreamnt
atggagacctctgctccgacagccactgagaaaaaggagcataagggatcaggtctggat
ggaagcagcttctcagacctgccaaagaaaccatctcccactactgtgaccagaggtcct
caccatctcttccccacgtttcacacaccgatcccaatcgatatgcgtcaccacgagggg
aggtaccattacgagccacaccccctccacgccatgcatggacatcatggcctagcaggc
agcccggtcatctcagacggcatctctctgatccgtctgtccccccacgcagcagggacg
ggggattcccccttcagcccacctcactcctacgtccacccccagatggagcactacctc
cgttccatgcacagcagccccaccctctccatgatctctgctgcccgcggactcagccct
gcagaagtgacccatgagcacctgaaggaacatggtctgttcagcctgccccctccacct
ccaggtgccaaccctacagattactaccacctcatggccagtggcaggagcacttacgga
gacctcatcatgcagaccggggcggccgcagcagcagcagccgcagcagcacacctgccc
gactacagccctgtggacgtgtcccggttctccagccccagactgacccccaggctgaac
agaaagcgagccctgtccatctcccctctctcagacgccagcatcgacctgcagaccatg
atccgtacctcgcccaactccctcgtggcctacattaacaactcacgctccagctctgca
gccagcagctcctacggacacctgtcagtcagcggcatcagtccgtcgttcacctttccc
caccccatcaaccccatggcctaccagcagctgctcaaccagcagagaggcctgagtgcg
ttcggccatactcctccccttatccagccctcgccctccttcgctgcccgccagcatgcc
cacgccctggcagcctccaccctcaacaccacccacaacacctccagctctgagtccaac
cagaatgctggtggggacccggcggtgagcagcacagtcaaccccatgatcaccaagagg
cacaaggtcaagacagaagcagaaggaccccggcccatatcaccatgctttcaggagcat
gtcctggacctgagtgaggagctggacaaagatgagtgtaagcaggagccagaggctgtc
tacgagaccaactgtcactgggtcggctgcagcaaggagtacgacacccaggaccagctc
gttcatcatatcaacaatgaccacatccatggggagaagaaggaatttgtgtgtcgctgg
gatgagtgctcgcgggaacagaagcccttcaaggctcagtacatgctggtggtccatatg
aggagacacactggagagaagccacacaaatgcacgtttgaaggatgctgtaaggcctac
tctcgcctggagaacctgaagacccatctgaggtctcacacaggggagaagccttacgtc
tgtgaacacgagggctgcaacaaagccttctccaacgcctcagacagagccaagcaccag
aacagaactcactccaatgagaaaccctacatctgtaagatccctgggtgcactaagcgc
tacacagaccccagctctctcaggaagcatgtgaagacggtccacggacctgaggcccac
gtcacgaagaaacaacgtggcgatgtgccccccaggggtcctcctaaggggaatggagag
aacgaggcaaacgccaaacagagtggtagagggatggatggaaaaatggtggccaacagc
accattagaggagcagaggactgcctgcaggtcaagtcaatcaagactgagaactcaata
acgtaccaatccagcccgggcggtcactcgtcatgtagcagtgagccgtcgccacttggc
agtgcccacaacaatgacagtggagtagagatggccctgcacagtgggggcagctttggg
gacctgagtgcactggatgaccctcccatggtggactcctccaccctctccccccgcaac
tcggtgggggtgggtcttgggcttcataaagggggaggagtcaccatcaagctggagaac
atcaagaaggagaggctgaagaatgtgagggactcttgtccctgggccaactctggtcct
caggcacctcaggtccgaaacaccaagctgcctcccattcctgctgttggttcccttctg
gaaaactctaatatgatcgctccacccgggccctaccctggtcagcgtcttggtgacctg
tcgtcatgtgaggtgaccatgctgaaccagctaaacgaacagggccgccgggacagcaac
accagcactgccagctcagcctacatcagtcggcgctcctctggcatctccccctgctac
tccagccgccgttcctccgaagcctcgcagttcagcaaccgccacaacaacatcagctca
gccgactcctacgaccccatctccacagacctgtcccgtagatccagcgaggccagccag
tgtggaggtggaaacctctctagtttgctcagcctcacccctgcccagcactaccatctc
aaggccaagtatgctgctgcaatcgggggagctccacctacacctctgcccaacatggag
cgtatgagcctcaggaccaggatggccctgtatggtgaccactcccaagaaagagagagc
ttatcccactgtcaactgttccacccacctaccgcagcagttcccagacgctgcagcgac
atcggctacagtagctatagcatgatgccccacgaggtccctgggaaccttccccggcga
gccagcgaccccgtccgcagacctaccctagacccactgtcccttccacgagtccaacgc
tacaacagcatgaacagtatgaaccccaacagtgtgatgcctcctccctctgccgaccgc
cggggcctggccatgcagagctacacgcgatccgacggaagcctgcaccaccaccccttc
gccccacggccccccagcatctcagagaacgtggtgatggagaccatggccgtggacggg
ctggaccatgcaggagatgaggacatggtgctgcctgatgatgtcatacagtacctcagg
tctcagaacactggccccggccaatcagcaggccccgccgactacgccaacagccaatca
caaggcggatttcaggtccaggggaatatgacctcctcccaacagcagttctatgggcag
aggaggatggcaatggtggatgccaacatgcccctgtctgggtcaggccaggctccccta
cccccctaccagatgagccctgggtctggctcccagcagcagcagtacccagcctctcac
agtatgaacaacaagaacaacatgccagtccagtggaacgaggtcagctcagggactgtg
gatgctacagccacctccagactcaccaagcagaacctcctcagaaacaacaacctggcc
atggtccagcagagacagaactttgggcatttccagggtagaatgggtagtaacagtaac
cagcaggtgatgcccatgaaccagaatatggcgctacaaggctacacccagagaagcaac
tcccagtggatcaactctgtccaacagcaacaaaggcagccatgcagcatgaactatcct
gagcagatgagtccccagcaaggatatggccaagaaatcatccctgtccctaactctgga
tctgggaatggcagcctacgacccaactttaatggcatggcactgcccaacagcagggtg
atggctacacacaacaatcctgatactcagatctacaggtcaaggactcaggttgaaagc
tatgtcccccacatgattcaggttgaccagcagaactacagtatttcttctcagcagcaa
gacgtcaatactgggaacagagttgggatgcagcccaggcctcccatggagcccaagtct
atgagcagtagacaacactcagggtccagaagtatgatgcagcagaaccgtttccctcag
tctgacttacatcacaacaccaatgaggccagtccaaagaggccgggtggcaccgcagca
cataccggcggacataacagagactcaaactccaatgcttcaatgttttatgctggccag
atccagatgtttgaacccaataacaaccacaatgtgagcttcaactcccccatgtccccc
ttcatgggccagactccgggaggcaccactgttaccatggcatctccaggggtcaaccag
gtcaccagcaccgttgactcatccggctcctctggatcgatctctggcgtggagcatgcc
cagatcgactttgacgccatgttggatgatggagaccactccagcctgatgtcagggacc
ctcagccccggactcctcaccagcctgtcccagaattcctcgaggcttaccaccccccgt
aactctgtgaccctggcctctgtgccagcaggaatcggtaatatggccatcggagacatg
agctccatgttgaccaccctggctgaggagagcaagttcctcaacatgatgagctaa

KEGG   Salmo salar (Atlantic salmon): 106590190
Entry
106590190         CDS       T04363                                 

Gene name
gli3
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106590190 (gli3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106590190 (gli3)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    106590190 (gli3)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4
Other DBs
NCBI-GeneID: 106590190
NCBI-ProteinID: XP_014036400
UniProt: A0A1S3Q8U7
LinkDB
Position
ssa29
AA seq 1666 aa
METQSQASSAAEKKKRVETIVATKGSSARADISEKAVASSTTSNEDESLGTPYHHHHHHR
ERRNAISTQAPTPGPPGSKLGEEPSTSTEERPPLVKKELHSSLPHLVDHGLPYRGTLFAM
DPRNGYLDSHYAPPQFFPAFHPPVPIDDRHAQGRYIYEPSPVPPLHVLCRPPSLAGSPAF
SDISLIRISPHRNPSVGAESPFNPPHPYINPYMDYIRSLHSSPSLSMISAARGLSPADVP
HTGLTTAEYYHQMAILAGHRSPYTDLLPSVASTAGATSSALHMEYLQAVESSRFPSPRLT
ARPSRKRALPISPLSEHSFDLQTMIRSSPNSLVTILNNSRSSSSTNGSYGHLSAGAISPA
LSFAYPPTPVALQMHQQLLGRQPGIVGSAFGHSPPLIHPSPAFATQRPVPGIPPPGLTPS
ERSVISNDSSQTKPTSESAVSSTGDPMHHKRSKIKPDEELLSPGAVCCQDHPDGMTLVKE
EGDKDDSKQEPEVVYETNCHWESCHREFDTQEQLVHHINNDHIHGEKKEFVCHWDECSRE
QKPFKAQYMLVVHMRRHTGEKPHRCTFEGCPKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQR
SDGFPRPPPQSREGGNGQGRSPGQLGGYADQREYNHATSKQDECLQVKSIKTEKPMTSQP
SPGGQSTCSSDQSPISAYPSHGVQLAVRGGVVGLGEGPGEEDEELEEEEEGLEVLEGGRD
APIMDSTVSTATAATLALQARRNVGRPMRWMEHMKMERLKQVNGGGGALMPRVGPLSPTP
PPKGPAVLGSCLGRLSQPQPPPRPELGSTELTVLSLLRGIEHGDRRDSSGSATSSAYLSS
SRRSSGISPCFSSRRSSQASQSEAANTPGHHRRHHNLSSTDSYDPISTDASRRSSEASQC
GGGGGVFVGGGWAGVGGGSKGMLNLTPAQHYHLKAKYAAATGGPPPTPLPNMERMSLKTR
MAMMCDGQDGCGGNHALPPLVRPRRCSDGSTTNGYGGHSGYRDYRRRGFYPGEGPGNGLD
RRASDPVRTQPQQTHPEFLGLPQVQRFSSLNNIHPLPPLSGLQHPTAEGRSFSLQNYTRS
EGNLQRGGLLSSPCPPSIMEHAALEALAMEEEGALLLGDEDMLPDDLVQYLHSQDLRSQD
QADSYNNHLENHVAGDNSHLPGGELQDQGPGLNQCIHSLQQHHQQQQGLERDGPSKDGMP
IQWNEVSSGSAERSPQRQPQVQAQQRCGRWAATEQHQGLGAGSSFGRFGNMVVQQQQQTV
TTRDFQNRCAQPGQPQPICRVNGGVKLEATTHSCMEMRGNGHNPTHTFGRPDFSQISVGP
LPQGYSQQQYQTQNHGTSRQIGDNLLLSRASVDSLTSLSQAPALHHHPQAPAPRLQQANS
SYRHPARPQQYLNAQQSTTNGSHVNLTQQNLTQQQQSLRNQVSHCSLAHQVSGLKLEAPD
QGYLDQSFSDQAVCFDPLETKTSSFSPMEEQCLLETMNEQVGLGGDSSVTASHLSPVADQ
VTSTVDSRAGGSVNVLDNVLPLDFGAMIEDVGVGYDQGSLVSGVISPSIFQGVSRNSSRL
TTPRVSATFHSTAGMMPSNLSNMAIGDMSSLLTTLAEESKFLAIMQ
NT seq 5001 nt   +upstreamnt  +downstreamnt
atggaaacccagtcccaggccagttctgcagctgagaagaagaagagggtggagaccatc
gtggcgaccaagggctcgtcggcgcgcgccgacatcagcgagaaggccgtggcctctagc
actacgtcaaacgaggatgagagcttgggcacgccgtaccaccaccaccaccaccaccgt
gagaggcgcaatgccatcagcacccaggcccccacacccgggccccctggcagcaagctg
ggtgaagagccctccacctccacagaagagcgcccaccgttggtaaagaaagagttgcac
agctcgctgccccacctggtcgaccacggcctcccgtaccgcggcacgctgttcgccatg
gaccctcgcaacggatacctggactcccactatgccccgccacagttctttcctgccttc
catccgccggtgcccatcgatgacagacacgcccagggacgctacatctacgagccgtcc
cctgttcccccgctgcacgttctgtgtaggcctccttcgctggccggcagcccggcgttc
tccgacatctccctcatccggatctccccccaccggaacccctccgtgggggctgagtca
ccatttaaccctccgcacccgtacatcaacccctacatggactacatccgctcgctccac
tccagcccctccctctctatgatctctgcagccaggggcctcagccctgcagacgtccct
cacacaggcctgaccactgcagagtactaccaccagatggctatcctggcgggccaccgt
agcccctacacggacctcctcccctccgtggcctccacagccggagccaccagcagtgcc
ctgcacatggaatatctgcaggccgtggagagctctcggttccccagccccaggctgaca
gcgaggcccagtcggaagcgggccctgcccatctctcccctgtcggagcacagcttcgac
ctacagaccatgatccgtagctcgccaaactccctggtcaccatcctcaacaactcccgc
tccagctcctccaccaatggctcttatggacacctctctgccggagccatcagtccggct
ttgagtttcgcttaccctcccactcccgtggcacttcagatgcaccagcagctgcttggt
cggcaaccagggatcgtgggttctgcattcggccacagtccgcccctcatccacccctcc
ccggccttcgccacccagcgtccagtcccgggcatccctccccctggcctgacccccagc
gagcgctccgtcatctccaatgactcctctcagaccaaacccactagtgagtcagcggtg
agcagcactggggaccccatgcaccacaaacgctccaagatcaaaccggatgaggagcta
ctcagcccaggggccgtatgttgccaggaccatcctgatgggatgactcttgtgaaggag
gaaggggacaaggacgacagcaagcaggagccagaggtggtgtacgagaccaactgccac
tgggagagctgccaccgggagtttgacacccaggagcagctagtacatcacatcaacaac
gaccacatccacggggagaagaaggagtttgtgtgtcactgggatgaatgttctcgggag
cagaagccctttaaggcacagtacatgctggtggtccacatgaggagacacaccggggag
aaaccacacagatgcacctttgagggatgtcccaaggcctactctcgcctggagaacctg
aagacccatttgcgctcccacactggagagaagccgtacgtctgtgaacacgagggctgc
aacaaggctttctccaacgcctccgacagagccaagcaccagaaccgcacacactccaac
gagaaaccctacgtgtgtaagatccctggctgcaccaaacgctacacggaccccagctcc
ctacgcaagcacgtaaagaccgtgcacgggccagaggcgcacgtgaccaagaagcagcgc
agcgacggcttcccacgtcccccgccgcagtcccgagaggggggcaacggacagggccgg
tcgccggggcaactaggggggtacgcagaccaaagggagtacaaccacgctacctcgaaa
caggacgaatgtctgcaggtcaagtccatcaagacggagaagcctatgacgtctcagcca
agccctggcggtcagtctacatgcagcagtgaccagtcccccatcagcgcctatcccagc
catggagtccagcttgctgtgaggggaggggtggtgggactgggcgaggggccgggagag
gaagacgaggagctggaggaggaggaggaggggttggaggtgttggaggggggccgtgac
gcccccatcatggactccacggtgtcgacagccacggcggctacgttggcgctgcaggcg
aggaggaacgtgggccggcccatgagatggatggagcacatgaagatggagaggctgaag
caggtgaatggaggagggggagccctcatgcccagggtgggccccctgtcccccacacca
ccacccaagggacctgccgtgctgggttcatgcctgggcaggttatcccagccccagcct
cctcctcgtcctgagctgggtagcacagagctgacggtgctcagcctgctccgcggcatc
gagcacggtgaccggcgggacagcagtggcagcgccaccagctcggcctacctgagcagc
agccggcgctcctcgggcatctcgccgtgcttctcgtcacggcgctccagccaggcgtcc
cagagcgaggcggccaacacccctggtcaccaccgccgccaccacaaccttagctccacc
gactcctatgaccccatctccaccgacgcctcgcgccgttccagcgaggccagccagtgc
gggggaggaggtggagtgtttgtgggtggagggtgggcgggcgtcgggggagggtccaag
ggtatgctcaacctcacgccggcgcagcactaccacctgaaggccaagtacgctgctgcc
acgggcggcccaccccccacgccgcttcccaacatggagcgcatgagcctgaagacccgt
atggccatgatgtgcgatggccaagacggatgtggaggcaaccacgcgctgcccccactg
gtcaggccgcgccgctgcagcgacggcagcaccaccaatgggtacgggggccacagcggt
taccgagactaccggcgtaggggcttttaccccggcgagggcccggggaacggcctggac
cggagggctagcgaccccgtgcggacccagcctcagcaaacccacccggagttcctcggg
ctgccccaggtccagcgcttcagcagccttaacaacatccacccacttccccctctatca
ggcctccagcaccccacggcagagggccgcagcttcagcctgcagaactacacccgctca
gaggggaatctccagagagggggcctgctttcctctccctgcccccccagcatcatggag
catgcggccctggaggccctggctatggaggaggagggagccctgctgctgggggatgag
gacatgctgcctgacgacctggtgcagtacctccactctcaggacctccgctcacaggac
caggcagactcctacaacaaccacctggagaaccatgtggctggggacaacagccatctc
cctggaggggagttacaggatcagggcccagggctgaaccagtgcatccacagtctccag
cagcaccaccaacagcagcagggactggagagagatggccccagtaaagacggcatgccc
attcagtggaacgaggtgagctcagggagtgctgagaggtctccccagaggcagccccag
gtccaggcccagcagaggtgtggccgatgggccgccacagagcagcaccaaggtctgggt
gccggttcatcattcgggaggtttgggaacatggtggtgcagcagcaacaacagacagtt
actaccagagacttccagaaccgctgtgcccagccaggccaaccccaacccatatgcaga
gtcaatggcggggtgaagctagaggcgaccacccactcctgcatggagatgagagggaac
ggccacaaccccacacacactttcggccggcctgacttctcccagatctctgtggggcct
ctgccccagggctatagccaacagcagtaccagacccagaaccatggaacctccaggcag
attggagacaacctgctcctcagccgggcctccgtggacagcctcaccagcctctcgcag
gccccagcgctccaccaccacccccaggcccccgccccccgcctgcagcaggccaacagc
agctataggcaccccgccagaccacagcagtacctgaatgcccaacagagcaccaccaac
ggtagccatgtcaaccttacccagcagaacctcacccagcagcagcagagtctgaggaac
caagtcagtcactgctccctggcccaccaggtgtctgggctgaagctggaggctcccgac
cagggctacctggaccagagcttcagcgaccaggctgtgtgctttgacccgctggagacc
aagacctcgtctttctctccaatggaggagcagtgtctgctggagaccatgaacgagcag
gtggggctaggcggggactcctcggtcacggcctcccacctctccccggtggctgaccag
gtgacaagcacggtggacagccgtgcgggcggctcggtcaacgtgctagacaacgtgttg
ccgctggatttcggagccatgatagaggacgtgggggtgggctacgaccagggtagtctg
gtgtcgggggtgatcagcccctccatcttccagggcgtgtcccggaactcgtcccgcctc
accacgccccgggtctccgccaccttccacagcaccgcgggcatgatgccctccaacctc
agtaacatggccatcggggacatgagctccctgctcaccaccctcgccgaggagagcaag
ttcctagccatcatgcagtaa

DBGET integrated database retrieval system