KEGG   Salmo salar (Atlantic salmon): 106566498
Entry
106566498         CDS       T04363                                 

Definition
(RefSeq) ETS domain-containing protein Elk-1-like
  KO
K04375  ETS domain-containing protein Elk-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106566498
   04012 ErbB signaling pathway
    106566498
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106566498
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106566498
   04912 GnRH signaling pathway
    106566498
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    106566498
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 106566498
NCBI-ProteinID: XP_013990055
UniProt: A0A1S3LGU5
LinkDB
Position
ssa13
AA seq 544 aa
MESNPLISAMDPSITLWQFLLHLLEDDSHRHLISWTSGDGEFKLLDAEEVARLWGLRKNK
TNMNYDKLSRALRYYYDKNIIKKVSGQKFVYKFVAHPDPSSVDCVRGGEDSQQQENLDSA
GQTKSPGGGSSNCPSKNLLMQRSSPVSVQRSSRNDYMKSGLYSTFTIQSLQAPCRTSPQP
IKTELLNQDSSPRPHSADRTLREVRAHDEDLSILTMVCLDGQSSSVQGCGSVESSLQVTL
THPSPCATPALSPQTLSVSNTGSSKSQPQKTQILCDPPQIYLTSVSDPGSLTPLTLTPVA
APGAPGECVVNQPQGHPVFVVIKPSPVVHSKEQNLTSEEDLVEIMSLEEKHVVEVPESAL
GPREPKTPLSIDVLPPCVEPVGQPVGEGEEEGKDEAHLPENSMTPAVALQAATLPAWSPQ
EVQPPKAKKPKVLELPSSSTLLPPGLSLDQVNAAVNSLLAPGSATNTLTPTVFTSHSLTP
VLLTPSPLPSTIHFWSTLSPIAPRSPAKLSFQFPSNGSNHIHIPALSVDGLSTPVVLSPG
PQKP
NT seq 1635 nt   +upstreamnt  +downstreamnt
atggagtctaaccccttaataagtgccatggacccgtccatcacgttgtggcagttcctg
ctgcatctcctcgaggacgacagccataggcacctcatctcctggacctctggggatggg
gagttcaagctgctggacgcagaggaggtggcacgcctctgggggctccgcaagaacaag
accaacatgaattacgataaactaagcagggcgctccgatactactatgataagaatatc
atcaagaaggtgagtgggcagaagtttgtctacaagtttgtggcccaccctgacccttca
tcagtagactgtgtcagaggcggtgaggattctcagcaacaggagaatcttgattcagcg
ggccaaaccaagtccccaggaggggggtcttctaactgcccctccaagaacctgctgatg
cagcggtcctctccagtctctgtccagcgtagctctcgcaacgactacatgaagtcaggg
ctctactccaccttcacaatccagtccctccaagccccctgcaggacctctccacagcct
ataaagactgagctgctgaatcaggactcttcccccagaccccacagcgctgaccggaca
ctgcgggaggtgagggcccatgacgaggacctctccattttaaccatggtgtgtctggat
ggccagagctcctccgtgcagggctgtggcagcgtagagagtagcctgcaggtcacactg
acacatccctcgccctgtgccacgcctgccctcagcccccagaccttgtcagtgtcaaac
acaggcagctcgaagtctcagccacagaagacccagatcctatgcgaccctcctcagatc
tatctgaccagtgtgtcggaccctggctccctcactcctctgaccctgacccctgttgct
gcacctggggccccgggggagtgtgtggtgaaccagcctcagggccaccctgtctttgtg
gtcatcaagccctcacctgtggtgcactccaaagagcaaaacctcacgtctgaagaggac
ctggtggagatcatgagcttagaggagaaacatgttgtagaggttcctgaatctgcattg
ggaccaagggaacctaaaacccccctctccattgatgtcctcccaccctgtgtggaacca
gtgggccagcctgttggggaaggggaggaagaaggcaaagatgaggcccatttaccagaa
aattccatgactccagcagttgctcttcaagcggctactcttccagcctggtcgccccag
gaagtacaacccccgaaagccaagaagcccaaagtcctagaactgccctcttcctcaacc
ctcctaccccctggtctgtcactggatcaggtcaatgctgccgtcaacagcctcctggcc
cctggaagtgccaccaacactctgactcctacagtgttcacctcccattctctgactccg
gtattactgacaccaagtcctctcccctccaccatccacttctggagcacactcagtccc
attgctccccggagcccggccaagctctcctttcagttcccctccaatggaagcaatcat
atccatatccctgccttgagtgtggacggcctgtctactcctgtagtgctgtcgccaggc
ccacagaaaccatga

DBGET integrated database retrieval system