KEGG   Salmo salar (Atlantic salmon): 106566842Help
Entry
106566842         CDS       T04363                                 

Definition
(RefSeq) paired box protein Pax-8-like
  KO
K09293  paired box protein 8
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106566842
Transcription factors [BR:sasa03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    106566842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 106566842
NCBI-ProteinID: XP_013990778
UniProt: A0A1S3LIL5
LinkDB All DBs
Position
ssa01
AA seq 474 aa AA seqDB search
MWKTYTELSRPEAVKFLARSDLIGHGGLNQLGGMFVNGRPLPEVIRQRIVDMAHQGVRPC
DISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIADYKRQNPTMFAW
EIRDRLLAEGVCDSDTVPSVSSINRIIRTKVQQPFNLPLDGKGLSPGHILIPSSAVTPPE
SPQSDSLGSTYSISGLLGIPQPSQEGKRSHDDSDQESCRHSVDSQGSGGVPRKQLRPEHF
PPQHLDCGFDHHHYPPDSFSSAAASKTEQTVYPLSLINGSLEDGKTSLSTSSAAIGRNLA
AHQGYTVVADPLQPLPLCLKQEMSPEVTSTSPSPNVVTNSAFLELQSLQAPVSISSSCSS
SNHFPHAFNSFSHHAPVYSQFSSQSLIAGRDMVSSTLPGYPPHIPSSGQTGYSTSAITGM
VAGADYSGQTYTHSPYTSYSEAWRFTNSSILGSPYYYSSASRTAPPSTAAYDHL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtggaagacatacacagagctgtctagaccagaagctgtcaaatttctagctagatcc
gacttaattggtcatgggggtcttaatcaactaggcggaatgtttgtgaacggccgtccg
cttccggaggtgatccggcagcgcatcgtggacatggcccaccagggcgtgcgtccctgt
gacatctcccgccagctccgtgtcagccacggctgtgtcagcaagatcctgggacgctac
tacgagactggcagcatcaagccaggtgtgattgggggctccaagcccaaggtggccact
cctaaggtggttgataaaatagcagattacaaacgccagaaccccaccatgtttgcctgg
gagatcagagacaggctgctggcagagggggtgtgtgacagcgacacagtgcccagcgtc
agctccatcaacagaataattcgaaccaaggtgcagcagccattcaatctgcctctggat
ggcaaaggcctaagcccaggacacatactcatccccagttcagccgtcactccccctgag
tcaccccagtccgactccctgggctccacctactccatcagtggcctgttggggatacca
caacccagccaggagggcaagaggagccatgacgacagtgaccaggagagctgtagacac
agtgtggactctcagggcagcgggggcgttcctagaaagcaactgagaccagagcacttc
ccaccgcagcacctggactgtggcttcgaccaccaccactatcccccagactccttcagt
tctgctgcagctagcaagaccgagcagactgtgtaccctctctcgctcatcaatggcagt
ctagaagacgggaagaccagcctctcaacatcgagtgctgctattggtcggaatctggca
gcgcaccagggctacactgtggtggcagaccccctacagcccctcccactttgtctgaaa
caggaaatgtccccagaggtgaccagcacaagcccctctccaaatgtggtgaccaactca
gcttttctggagctgcaatcgctgcaagcccctgtgtctatcagtagcagctgcagcagc
tccaaccatttcccccatgccttcaactcattctcccatcatgcaccagtgtacagccag
ttcagcagccagtctctcatagcaggaagggacatggttagctccactctccccggctac
cctcctcacatcccctccagtggccagacaggctactcaacctccgccatcactggcatg
gtagcaggtgcagactactctggccagacctacactcactccccctacacctcctacagt
gaagcttggagattcaccaactccagcattttgggttcaccctattactatagctcggcc
tcccgcaccgctccaccatccactgcagcctacgaccatctctag

DBGET integrated database retrieval system