KEGG   Salmo salar (Atlantic salmon): 106566930
Entry
106566930         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106566930
   04020 Calcium signaling pathway
    106566930
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106566930
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106566930
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106566930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106566930
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106566930
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106566930
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like
Other DBs
NCBI-GeneID: 106566930
NCBI-ProteinID: XP_013991007
UniProt: A0A1S3LJ66
LinkDB
Position
ssa13
AA seq 763 aa
MGSVRCTPPVPLPTNLPVLEAKVDNLTHKLDELLSRQIGSCSICSTCSLHSGQTDATERQ
LVAQSRLLENFERKIGEMQRTLEALAKGLEQRNPHTCQEASPAPPIEPSPRTVYLPARTS
LVTSKDEIPDQLETNRQQDKTQHTPTTPAKKETDAKKTLTRLAVAVFPSMAHTQKILTQT
RTTVTKNQAVKSIEASLRTASLPVSDSLSTEKAETQNQFEMNRHQETKQQTPIAPAKNGV
SAGMGAEQRDCVGERWIGENQQGVRSQPMAADSHRQSETKRGGMREVPAVAVVPSMADTP
KTETRTAVTENQAAAPSSPAPAPKKQSGLAVLMPTVESSPLRQVHSCPESLQRLQSSRPR
PQSVCPARGPAVGKTCSVLARDSPVAASGIQIIVVPTTAERTRPKSPTKTCHKVIDDVPP
QPAPFLHRCVSLRSNPPSDTFIIHTREVLGSGRFGKVHKCTEKSSGLKLAAKIINTRTAK
EKERANNEVQAMNQLSHPNILQLYEAFEAKHQLVLILEYVEGGELFDRIVDESAPLTEVD
AMVFVKQICEGVSYMHQMYVLHLDLKPENILCVNRTGHQVKIIDFGLARRYRPREKLRVN
FGTPEFLAPEVVNFDFVSFPTDMWTLGVVTYMLLSGLSPFLGDDESQTLNNVLSANCSFE
DEAFEHISAEAKDFISHLLVKERGGRMSALQCLRHPWLNNIAEKAKGSNIVLKSQVLLKK
YLAKKLWKKNYIAIAAANRFKKISSGGELTSLDTETDTVPIAT
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgggttccgtgcggtgtacgccacctgtcccactccccacaaacctacctgtcctagag
gccaaagtcgataacttgactcacaagttggatgagctcctctccagacaaataggttcc
tgctccatctgctccacctgcagtctgcacagcggccagacagatgcaacagaaaggcag
cttgtggcccagtccaggctgctagagaactttgagaggaagatcggtgagatgcagagg
accttagaggccctggccaaaggtctggagcaaaggaacccccatacctgccaggaagct
tccccagccccacccattgagccatcacctaggacagtatatctgccagccaggacctca
ctagtcacttctaaggatgagatcccggatcagttggagacaaacagacagcaggataag
acacaacacactcctaccaccccagcaaagaaagagacagatgcaaagaaaacattgaca
cggctggcagtagcagttttcccatcaatggcgcacactcaaaagattttgactcagaca
aggaccacagtgacgaagaaccaagcggtgaaatccatcgaggcgtcacttaggacagca
tctctgcccgtcagtgattcattaagcactgaaaaggctgagacccagaatcagtttgag
atgaacagacaccaggaaacaaaacaacagactcctatcgctcctgcaaagaatggggtg
tctgctggtatgggagcagagcaaagagactgtgttggagagcggtggattggagagaac
cagcagggggtcagaagtcaaccaatggcagcagattcccacagacagagtgaaactaaa
aggggtgggatgagagaggttccagctgtagcggttgtaccatcaatggcggacactcca
aagactgagacgaggaccgcagtgacggagaaccaagcagctgctccatcaagtcccgcc
cccgccccaaaaaagcagtctgggttggctgtccttatgccaaccgtggagagctccccc
ctcagacaagtgcacagctgtccagagtccttgcagaggctccagagctcaaggcccagg
ccccagtctgtctgccctgcccgtggacctgctgttgggaagacctgcagtgtgttggca
agggatagtccagttgcagccagtggaatacagatcatagtagtccctactacagcagaa
aggacccggcccaagtcccctaccaaaacttgccataaggtcatagatgacgttcccccc
cagccagctcctttccttcaccgctgtgtgtcgttgcgatccaaccccccatctgacacc
ttcatcatccacaccagagaggtgctggggagcggacgctttggcaaggtgcacaaatgc
actgaaaaatcctctggactaaagctcgcagctaagataatcaacacacgaactgctaaa
gagaaggaaagggcaaataacgaggtgcaggcaatgaaccagctgagtcatcccaacatc
ctccagctctacgaggcctttgaggccaagcaccagctggtgttaattctggaatatgtt
gagggcggggagctgtttgacaggattgtggatgagagcgcaccgttgaccgaggtggac
gccatggtgtttgtcaagcagatctgtgaaggggtcagctacatgcatcagatgtacgtc
ctccacctcgacctgaaaccggagaatatcctttgtgtgaatcgaactggccatcaggtg
aagattatcgactttgggttagcaagaagatacaggcctcgggagaagctcagagtcaat
tttggaacccctgaatttctggccccagaggtggtcaactttgattttgtgtcctttccc
acagacatgtggaccttaggggtcgtcacttatatgcttctaagtggcctttcacccttc
ctgggtgatgatgagagccagaccctcaacaacgtcctctctgccaactgttcttttgag
gacgaggcctttgagcacatctcagctgaggccaaggactttatctcccaccttctggtc
aaggagaggggagggcgaatgagtgctttacagtgtctaagacatccgtggctcaacaac
attgcagagaaggccaagggcagcaatatagtactgaagtcccaggtcctgctgaagaaa
tacctggccaagaaactatggaagaaaaactacattgcgatagcagcagccaacagattc
aagaagatcagcagcggtggggaactgacctctctggatacggagacggatacagtacct
atagcaacgtaa

KEGG   Salmo salar (Atlantic salmon): 106584199
Entry
106584199         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase family member 4-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106584199
   04020 Calcium signaling pathway
    106584199
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584199
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584199
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106584199
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106584199
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106584199
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106584199
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo NACHT_N Kinase-like
Other DBs
NCBI-GeneID: 106584199
NCBI-ProteinID: XP_014024681
UniProt: A0A1S3PAU7
LinkDB
Position
ssa23
AA seq 777 aa
MVDRSAAEPTMSSSLVNSLAKVYDPNPLHGQKLAGTKLIRSPTGPDKQLQTPSSPSSSSS
SSPVIATWCVETESRMDSLSSQMERLINLQETVLTRLDGLSRDLGGVGREVASLRAGAWG
SAGGLGQTQGKTQTQGVEVEGQAQEVAAACRVLQGVVQEASQRVEQQGQRLEGVERLVEG
MHQVIGFIGEVVKSSMLAELLFKKPGGCKGAKAKQARKLKDNGMRDGKDKAKLSLKCLKA
QKKKKPPDVSDSVEALLLDQVEKLNRQNAERSHGNGVVLDMPRIPVVQPDDMEELEGKEE
EKRKTPDQEEEQRAREEEEEEGDIFGESDPEEEEGREGEALKIKVEHVQEEDGEKRGEGG
EKESSEPLESSEELGEVAASSKRGVQEEYWVKDNLKKSRVEEKKDGEEEEGRVPEGSELQ
AAQSEAEKTEKEEEVDDGQPKEYIIDSSPPPAAPFDHRIVTPKPHQVTTFYAINREEVLG
GGRFGQVHKCVENSSGLKLAAKIIKARSQKEKDVVKNEIQVMNQLNHANLIQLYAAFESS
HDIILVMEYVDGGELFDRIIDENYNLTELDTVLFIRQICEGLQYMHKMYILHLDLKPENI
LCVSRATNKIKIIDFGLARRYKPREKLRVNFGTPEFLAPEVINYEFVSFPTDMWSLGVIT
YMLLTGLSPFLGDDDNETLNNILACQWNFEEEEFTDISEEAKDFIARLLIKSNSWRMSAS
QSLKHSWLSDRNLHYRLHQKKNKCHSTHPHPPRKSRQSPIQNESPLQNDAQDPVGTL
NT seq 2334 nt   +upstreamnt  +downstreamnt
atggttgaccgctctgctgcggaacccaccatgagctccagcctggtcaactctcttgcc
aaggtgtacgaccccaaccctcttcatggtcagaaactggccggaacaaagctgatacgt
tcacccactggacctgacaaacaactccagacaccgtcctcaccctcttcctcctcctcc
tcttctccggtcattgctacatggtgcgttgagactgaaagccgcatggactctctaagc
agccagatggagcgtctgattaacctccaggagaccgtcctcacccggctggacggactg
tcccgggacctggggggcgtggggagggaggtggcctctctccgggccggggcctggggg
tcggctggaggtctgggccagacccagggtaagacccagacccagggggtggaggtggag
ggtcaggcccaggaggtggctgcggcctgtagggtgctccagggggtggtgcaggaggcc
agccagcgagtggagcagcaggggcagaggctggagggagtggagaggctcgtggagggc
atgcatcaggtcatcggtttcatcggagaggtggtgaagagctctatgctggctgagctg
ctgtttaaaaagcctggaggctgtaagggggctaaggccaaacaagccaggaagctgaag
gacaatgggatgagggatgggaaggacaaggccaaactcagcctgaagtgcctgaaagcc
cagaagaagaagaagcctccagatgtatcagactctgtagaggccctccttctagaccag
gtagagaagctcaacaggcagaatgctgagcgttcccatggtaatggggtggttctggac
atgccccgcatccccgttgtccaaccagatgacatggaagagctagaggggaaggaggag
gagaagaggaaaacccctgaccaggaggaagagcagagggccagggaagaagaggaagag
gagggggatatatttggtgaatctgaccctgaggaagaggagggaagagagggagaggca
ctgaagattaaggtggagcacgttcaagaggaagacggggagaagagaggggaaggaggg
gagaaagagtcatcagaacctctagaaagttctgaggagttaggtgaggtggctgccagc
agtaaacgtggcgtccaagaggagtattgggtgaaagacaacttgaaaaagagtcgagtg
gaggaaaagaaagatggggaagaggaggaaggaagagttcctgagggttcagagcttcag
gctgcccaatcagaggcagagaagacggagaaggaagaggaggtggatgatggacagcca
aaagagtacattattgactctagccctccgccagcagccccctttgatcaccgcatcgtg
acacctaaacctcaccaggttactaccttctacgccattaacagagaggaggtcctagga
gggggacgttttggacaagtccataaatgcgtagagaactcttctggactgaagcttgcc
gccaagattatcaaagccaggagccagaaagagaaggacgtggtgaagaatgagatccag
gtgatgaaccaactcaatcacgccaacctgatccagctctacgctgccttcgagtcaagc
cacgacatcatcctcgtcatggaatatgtggatggaggggagttgtttgaccggatcata
gacgagaactacaacctgacagagctagacacagtgctgttcatcagacagatctgtgag
ggattacagtacatgcacaagatgtacatcttacatctagacctcaagccagagaacatt
ctgtgtgtgagcagagctacaaacaagatcaaaataatagactttgggcttgcaagaagg
tataagcccagggaaaagctgagggttaattttggaacgccggaattcctagctcctgaa
gtcatcaactatgaatttgtctcattccctacagacatgtggagtctgggagtcatcaca
tacatgctgctgactggtctgtctccattcctgggtgacgatgacaacgagactctgaac
aacatcctcgcctgtcagtggaactttgaggaggaggagtttacagacatctctgaggag
gccaaagacttcatcgcgcgcctgctgatcaagagcaatagttggaggatgagtgcctca
cagtcactgaaacattcctggctgtcggaccgtaatcttcactaccgcctgcatcagaag
aaaaataagtgccactcaacacaccctcaccctccccgaaaatctagacagtcccccatc
cagaatgagtctcccctccaaaatgacgcccaagaccctgtgggcaccttatga

KEGG   Salmo salar (Atlantic salmon): 106586160
Entry
106586160         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106586160
   04020 Calcium signaling pathway
    106586160
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106586160
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106586160
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106586160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106586160
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106586160
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106586160
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig Pkinase PK_Tyr_Ser-Thr V-set C2-set_2 fn3 Kinase-like Kdo
Other DBs
NCBI-GeneID: 106586160
NCBI-ProteinID: XP_014028544
UniProt: A0A1S3PLI4
LinkDB
Position
ssa25
AA seq 1854 aa
MGDVQLVTTRISKTSLTQGQGSPSQDPPAFTLPPRNARVSPGGTARLDGKVRGYPEPQVT
WSRNGKAVIAGERFVMEQSSRGTFNLVVHCVQEEDAGRYTCEAVNDAGSRQVTVEITIEG
KKSSLPSSIRTGGRFGVSTMESMPSIWGESPPKFVTRPSRIFVRMGQSGKFSAKITGRPQ
PLVTWLKGDEELHASSHFNMFEKSGIHFLEIRDVCVDDAGMYTCSVANSAGKATATAELN
VQGSGSEAGILGPSAPVAPVPKTTDSPEVKHTSNGLLADRRSPTKTGDRTETRERLTTLT
RETKGSTEPTKATWKATMASPKTTIVTSPKPPADLPDEAPRKPGVATPKAASSTTLQHHL
RGQGAARTSPDPHNRAPERDTRDRVKTPPVGVQSPPQPSPEPTRETRRQARESRSARAAV
TAGAPPKFDSVPQSQDTKEGTKVAFKCQVSGSPVPALSWVKDGFPLRPRAGLTFQQDGNT
HILTVDNVQKRDSGTYGCTMTTSAGKVSSTWNLTVKNPRLEGKPPAFSTVLKGCSVSEGQ
DFLLQCSVQGEPLPNIFWLLNDKPVPHAHSAFENGLTQLAVQGALPEDEGQYACVAENSH
GRAVCTSRVIVKGGLGSLYSGPKKNFKRMDPPNAVDTKKPSKPSAPVFLRGLKDLKVMDG
SKVIMTVEVTGNPHPEIVWLHNGKEIQESEDFHFERKGSQYSLFIQEVFPEDTGKYTCEV
WNEVGEVRTEASLTVQEPQDGVQPWFITKPKSTTASLGQNVLLSCAIAGDPFPQWSWMKQ
GQVVTTGLDYEILQKEDVVSLLIRRVRSHHAGDYEISLRNKVGDCSCVATLLVSEGAVVS
SGEHQTLEPCQRVGGVDGTVRGRGAPSSSSIQQQQEPVESEEPSAAQGLLKRRVETKEHR
EDQIRLQEAEQRDFRTVLGRKVTTKSVSEEDLKEITAEQMDFRSQLQPRGVKPKTLSEDE
RKVNAPAQVDFRAVLGKKGGAAKPGAVPAEKGEPADFRSVLANKKKQTSLENNGKSPAPA
AALARAAATPKAPASSPDKKEKEKNAVNCVDGGIIDKKSNNIGKEPAFSQKLSDVSVVDG
ARLRLQCQVTCDPPATITWTLDGKVIKPSKFIKLSNEGGQCSLTIDKALPEDEGQYKCRA
ENSAGKAECSCMVLVDDPTDTNSTAADKKIKKPSTPTSESEARIKKPNTKMSPKQAMPPQ
IVQFPDDMKILAGEKVEILCKFGGAPPVNCTWLKFRKPIQEVKGVLTIETTEVTSKLTIA
DSQQDHCGCYTIELRNSYGLRQAALNLTIVDKPDPPARVPAASDIRRSTLTLSWYGPTYD
GGSAVQSYNLEIWNSVDKEWKNLVSCNSTSYNVQNLLGQRQYKFRVRAVNIYGIGEPSAE
SEAVTMLEEDVEEKEEVEDDEEKEPDYRDVIVRTDVKVKDLYDVEERLGTGKFGQVFKLL
EKATKKHWAGKFIKAYSAKEKDNVRQEIAIMNSLHHPKLVQCIDAFEGKSDIVMVLEMIS
GGELFERIIDEDFELTEREVIKYMLQIVDGVHYIHKQGIVHLDLKPENIMCVNKTGSTIK
LIDFGLARRLESSGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSGLSPFM
GDNDNETLSNVTSATWDFEDDAFDEISDHAKDFITNLLKKDMRARLTCDQCYEHPWLKQD
TGKMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSMAMLAGVSAKKGSPTEEDNQFL
ECLEYEEKTQVKPTFSSVIKDVEVVEGSAARFDCKIEGYPDPEVVWYKDEQPIKETRHFQ
IDYDEEGNCSLVISEVNGDDDAKYTVKAVNSLGEATCTAELLVEVMEEEEEEEE
NT seq 5565 nt   +upstreamnt  +downstreamnt
atgggggatgtgcagcttgtgacaacgcggatctccaagaccagcctgacacaaggccaa
ggttccccaagtcaggatcctccagccttcactctcccaccccgcaatgcccgggtcagt
ccgggagggacagcgcggctggatggaaaggtgagaggataccctgagccccaggtcacg
tggtccaggaatgggaaagcagtcatagctggagagcggttcgtcatggaacagagtagc
cgtggaaccttcaacctggtggtacattgtgtccaggaggaggatgcagggcgctacaca
tgtgaggctgtcaacgatgctgggagccgccaggtcacagtggagatcactatagaaggg
aagaaatccagcctcccctcctccattagaacaggcgggcggtttggagtgtcaaccatg
gagagcatgcccagtatctggggggagagcccccctaagtttgtgacgaggccttcacgc
attttcgtccgaatgggacagagtggcaagttctctgccaaaatcacaggacgcccacag
cccctggtaacctggcttaagggagatgaagagcttcatgcttcttcccacttcaacatg
tttgagaagtcgggaatccacttcctggagatccgagacgtgtgtgtggacgatgcagga
atgtacacctgctctgtggccaacagtgctgggaaggccacagctacagcagagctgaat
gttcagggttcaggcagtgaggctggcatccttggtccctctgctccggtggcccctgtc
ccaaagacaactgactcacccgaagtcaagcacacaagtaacggcctgctcgctgaccga
cgttcacctaccaagacaggagacaggactgagaccagagagagactcaccacactcacc
agggagaccaaaggcagcacagagccgaccaaagcaacatggaaggccaccatggcgtct
cccaagaccaccatcgtgacgtctcccaagccccctgcagacctgccggatgaggcccct
agaaagcctggggtggcaaccccaaaggctgccagctccaccactttgcaacaccatcta
agaggccagggggctgctaggaccagcccagacccacacaacagagcccctgagagggat
acaagggatagggtgaagacccccccagtgggagtccagagccccccacagccatctcca
gagcccactagagagactagaaggcaggccagagagagcaggtcagcgagggcagcagtg
actgctggagctccaccaaaatttgactctgtacctcagagccaggacactaaagagggg
accaaagtcgcattcaaatgccaagtctcaggttctcccgtgcctgccctgagctgggtt
aaagatggcttccctttgagacccagagcagggctgaccttccagcaggatggcaacact
cacatcctcactgtggacaacgtccagaaaagggacagtgggacgtacggatgcaccatg
actactagtgctgggaaggtgtcctcgacttggaacctcacggtcaagaacccacggctg
gagggaaagccccctgcgttcagcactgtcctgaagggatgttcagtgagtgagggccag
gacttccttctgcagtgttcagtgcagggggagcctctacctaacatcttctggctccta
aacgacaagccagtgccgcatgcccactctgcctttgagaatggcctgacccaactcgca
gtccagggtgcactgccagaggacgaaggccagtacgcgtgtgtcgctgagaacagccat
gggagagcagtgtgcacttccagagtcatcgtcaaaggtgggcttgggagcctctacagt
ggccctaagaaaaatttcaagaggatggaccctccaaatgcagttgacaccaagaagcca
tcgaagccatctgcccctgtattcctacgaggtctgaaggatctgaaagtcatggacggc
agcaaagtcatcatgaccgtggaggtgacggggaatcctcatccagagattgtgtggctc
cacaatggaaaggagatccaggagtcggaggacttccactttgagcggaaggggagccaa
tacagtctgttcatccaggaagtcttccctgaggacactgggaagtacacctgtgaggtg
tggaacgaagtgggagaggttcgcaccgaggcctcactcactgtacaagagccccaggac
ggggtgcagccctggttcatcactaagcccaagtccaccactgcctccttggggcagaat
gtcctgctgtcctgtgccatcgctggcgaccccttcccccagtggagctggatgaagcag
ggccaggtggtgaccactgggctggactatgagattctgcagaaagaggatgtggtgtcc
ctgctcatcaggcgagtccggtcccaccacgccggggactacgagatcagcctgaggaac
aaagtgggggactgcagttgtgttgccactctgttggtcagtgagggtgctgtggtgtcc
agtggagagcaccaaacgcttgagccttgtcagcgtgtgggaggagtggacgggacagtg
cgaggcagaggagcaccgagcagcagctccattcagcagcagcaggagccagtggagtca
gaggagcccagcgcagcccagggactcctgaagaggcgcgtggagaccaaggagcaccgc
gaggaccagatccgcctgcaggaggccgagcagcgtgacttccgcacagtgctgggcagg
aaagtcaccaccaagagcgtctccgaggaggacctgaaggagatcacggcggaacagatg
gacttcaggagccagctccagcccagaggggtcaagcccaagaccctgtctgaagatgag
aggaaggtcaacgctcccgcgcaggtggacttcagagccgtcctggggaagaagggggga
gctgcgaaaccaggcgccgttcctgccgagaaaggagagcctgcagatttcagatcggtt
ctggccaacaagaagaagcagacgagcttggagaacaacgggaagagccctgctccagca
gcagctctggcacgggcagcagcaacacccaaagctcctgcttcttcccctgacaagaaa
gagaaggagaagaacgctgtcaactgtgtggatggtgggattattgataagaagagtaac
aacattggaaaggagccagcgttcagtcagaagctgagtgacgtgagcgtggtggacggg
gctcgactgcgactacagtgccaggtgacctgtgacccccctgctactattacctggaca
ctagatgggaaggtcatcaagccctccaagtttatcaagctgtccaacgaaggaggccag
tgctccctgaccatcgacaaggccctgcccgaggacgagggccagtacaagtgccgggca
gagaactctgccggtaaagctgagtgttcctgcatggtgctggtggatgatcctacagac
acaaactcgactgcagctgacaagaagatcaagaagccatccacccctacctcagagagt
gaggcaaggataaagaaaccgaatacaaagatgtctcccaaacaggctatgccccctcag
attgtccagttcccagacgacatgaagattctggcaggggagaaggtggaaattctctgt
aagtttggaggagctccaccagtcaactgcacctggctcaagttccgcaaaccaattcaa
gaggtcaaaggtgttttaaccattgaaaccactgaggttaccagtaaactgaccatcgca
gacagccagcaggaccactgtggctgctacaccatcgagctgcgaaacagctacggcttg
agacaggcagctctcaaccttaccattgtcgacaaacctgatccccctgcacgagttcca
gccgcctcagacatccgccggtccacactcacactgtcatggtatggccccacctacgac
gggggcagcgccgtccagtcctacaacctagagatatggaactcagtggataaggagtgg
aagaacctggtctcctgcaacagcacctcctataatgtccagaacctgctgggtcagcgc
cagtacaagttcagggtgcgggcggtcaatatctacggcatcggggagcccagtgccgag
tctgaggctgtcacaatgttagaggaggatgttgaggaaaaggaggaggttgaggatgat
gaagagaaagagccagactacagagatgtgatcgttagaacagatgtgaaagtcaaggat
ctgtatgatgtggaggagaggctcggaacggggaaattcggacaggtattcaaacttttg
gagaaggcaacgaaaaagcattgggctggaaagttcatcaaggcctactctgcaaaagag
aaagataatgtgagacaagagattgctataatgaactccctccatcaccccaaacttgtc
cagtgcattgatgccttcgaaggcaagtcggacatcgtcatggttttggaaatgatctct
ggtggggagctgtttgagcgtatcatcgatgaagactttgagctgacagaaagagaggtc
attaagtacatgctgcagattgtggacggggttcattacatccacaagcagggcatcgtc
catctggacctcaagcctgagaatatcatgtgtgtcaacaagaccgggagcaccatcaaa
ctcattgacttcggccttgctcgcagactagaaagctctggaacattgaaagttctgttt
ggaacccctgagtttgtggcccctgaagtgatcaactatgaagcaatcagttacccaaca
gacatgtggagtataggagtcatctgctacatcctggtgagtggcctgtccccattcatg
ggggataacgacaacgagaccctttccaatgtgacctcggccacctgggactttgaagac
gacgccttcgatgagatctcagaccacgccaaagacttcattaccaacttgctgaagaaa
gatatgagggctagactgacatgtgatcagtgctatgagcacccgtggctaaaacaagac
actggcaaaatggaggccaagaagctgtccaaggagaggatgaagaagtacatcttgaga
aggaaatggcagaaaaccggacatgcagtgcgggccatcggaagactgtcgtcaatggcg
atgttggcgggcgtcagtgccaagaaaggctcccctactgaagaggacaaccagttcctt
gaatgcctagagtatgaggagaaaacccaggtcaagcccaccttcagctcagtcatcaag
gatgtggaggtggtggaggggagcgcagccagatttgactgcaagatcgagggctaccct
gatccagaggtggtgtggtataaagacgaacagccgatcaaggagacccgccacttccag
attgattacgacgaggagggcaactgcagcctagtgatctcggaagtgaacggcgacgac
gatgccaaatacactgtcaaggctgtcaacagcctaggcgaggccacttgcacagccgaa
ctcctggtggaggtgatggaggaagaggaggaggaggaggaatga

KEGG   Salmo salar (Atlantic salmon): 106587297
Entry
106587297         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase 3-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106587297
   04020 Calcium signaling pathway
    106587297
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106587297
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106587297
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106587297
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106587297
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106587297
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106587297
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo APH
Other DBs
NCBI-GeneID: 106587297
NCBI-ProteinID: XP_014031027
UniProt: A0A1S3PTL6
LinkDB
Position
ssa26
AA seq 829 aa
MSKPETLASCIAKMYEGGKLDNAGAPSGAMKKPTNSLLNSLGGMEVKLNQLEVKVEQIAC
SQTEVLRRLDMVCQGMGMLEKDLAQLRKDKDPQAGDKGSRGGGGDPALFSEVRVLCGETV
ALLKNLQKEGKWQREKIEGIESSVSAVDKLWGYVGEVFRSSKIVEFILKGIVPWRKQGLL
YIQEEEEKTKSEDSRVKPKVTLCNQGTQVQEEGLQIATGDQKALELPVKEAKAADHGVEV
PTTPEPDPCRLSEALTEGPAVDQALFPSTNSDWGSKGSRKPKEVTLKSREPTRVQTFAPD
VVVAQVEVTIEVLSELRRTPDVTMISVSSELDSQYIKVKETEVPQGPEPTVSQPPISTTE
EQPPEQPPEQVPESVSLPSKDDTLPEEDFTKAAVSPQEPVIIVTPPTPYSSALTSPLDVV
TKPESVTIVPQVQPEPVAVTEQHKSVPPQPESETVKDSAKPVIPQPTPSLVVKNPTAAAQ
AAGLDAQLLVIDDCPPLPAPFEHRIVSAKQVPMGSYYAVKPNAVLGGGRFGQVHKCAELS
SGLILAAKLIKVKGMRERDEVKNEIGVMNQLNHVNLIQLYDAFESRTNLTLIMEYVEGGE
LFDRIVDENYQLTELDAIVFMRQICEGVQYLHQQYILHLDLKPENILCVNSTGNQIKIID
FGLARKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPFLGDN
DAETMNNILHANWDFDSEAFENVTEEAKDFVTRLLIPTKCSRLSATGCMKHAWLNNLEDK
AKLHQVRLKSQVKLQRYLAAHKQWKKHFYVVAAANRLKRFRQNHPINTV
NT seq 2490 nt   +upstreamnt  +downstreamnt
atgagtaaaccggagacattggcctcctgcattgccaagatgtacgaggggggtaaattg
gacaatgctggggccccttctggagcaatgaaaaagccaactaacagccttctgaacagc
ctgggaggcatggaggtcaagctgaatcagcttgaggtgaaggtggagcagatagcctgt
agccagacagaggtcctcaggaggctggatatggtgtgccagggcatggggatgctggag
aaggacctggcccagctcagaaaagacaaggacccccaggcgggggacaagggctctcgt
ggaggtggaggggacccagccttgttctccgaggtcagggtactgtgtggggagaccgtg
gcgctgctgaagaacctgcagaaggagggtaaatggcaacgggagaaaattgaaggaata
gagagctcggtttcggccgtggacaagctctggggatatgtgggggaagttttccgaagc
tctaagatagtggagttcatcttgaaaggcatcgtaccctggaggaaacagggcctactg
tacatccaagaggaggaggagaaaactaaatcagaagatagcagagtaaagcctaaagtc
actctctgcaaccaggggactcaggtccaggaagagggcttacaaatcgccacaggtgac
cagaaggcgctagagctccctgtaaaggaagcgaaggccgcagaccatggagtggaagtc
ccgacaactcctgagcctgatccctgcaggttatccgaagctctcacagagggccctgca
gtcgaccaggccttattcccatctaccaatagtgattggggtagtaaaggctctcgcaag
cccaaagaggtcaccttaaagagcagagagcccaccagagtccagacctttgcccctgat
gtggtcgtagctcaggtggaggtcaccatcgaagtgctctctgagctgaggaggactcct
gatgtgaccatgatttcggtgagcagtgagttagacagtcagtacatcaaagtcaaggag
acagaggttccacaaggtccagagcccactgtatcacagccacctatctccaccactgag
gagcaaccgccggagcaaccgccggagcaagtccctgaaagtgtttctcttccttccaag
gatgacactctccctgaagaggactttacaaaggctgcagtcagtcctcaggagcctgtt
atcattgtaacaccaccaaccccgtacagcagtgcgctaacaagcccactggatgtggtc
accaaaccagagtccgtaacgattgtccctcaggtccagcctgagccggtggcggtcaca
gagcagcacaaatctgttccacctcaaccagagtctgagacagtgaaagactctgcaaaa
ccagttatccctcagccaactccctctttagttgttaaaaaccctacagcagctgcacag
gcggcaggcctggatgcacaactattggtcatagatgactgcccacccttgcccgctccc
tttgagcaccgcattgtgagtgccaagcaagtaccgatgggctcttattacgctgtaaag
cctaacgcggttcttggagggggacgttttgggcaggtccataagtgcgcagaactgtcg
tcgggcctaatcctcgctgcgaagttgatcaaagtaaagggaatgagggagagagatgaa
gtgaagaatgaaataggggtgatgaaccaacttaaccatgtgaacctgattcagctttat
gatgcctttgagtcacggacaaaccttacgcttattatggagtatgtggaaggtggtgag
ttgtttgaccggatcgttgacgagaactaccagctgacagagctggatgccatcgtgttt
atgagacagatctgtgagggggtacagtacctccatcagcaatacatcctccatttagac
ctcaagccagagaacattctttgtgtcaactccacagggaaccagatcaagataatagac
tttggtctggccagaaagtacagacccagagagaaactaaaggtcaattttggcactcca
gaatttctggctcctgaggtggtcaactacgactttgtctcattcccaacggacatgtgg
agcgtaggagtcattacttatatgcttctgagtggactgtctccattcctgggggacaac
gatgcagagactatgaacaacatccttcacgccaactgggattttgattcagaggcattt
gagaatgtcacagaggaagctaaggactttgttaccagactgctgattccaactaaatgc
agtcgactcagtgcaactggctgcatgaagcatgcctggctgaacaatctggaggataaa
gccaaattacaccaggtgcggctcaagtcccaagtcaagctccagcgctacctggccgct
cataaacagtggaagaaacacttctatgtggttgctgcagccaacaggctgaagaggttt
cgccagaatcatcccataaacactgtatag

KEGG   Salmo salar (Atlantic salmon): 106599743
Entry
106599743         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase 2, skeletal/cardiac muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106599743
   04020 Calcium signaling pathway
    106599743
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106599743
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106599743
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106599743
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106599743
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106599743
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106599743
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo HSBP1 DUF1664 Kinase-like XhlA
Other DBs
NCBI-GeneID: 106599743
NCBI-ProteinID: XP_014046518
UniProt: A0A1S3R2C9
LinkDB
Position
ssa03
AA seq 840 aa
MSSKIVNYNSTSRKPSMMDNVTDCNGAGLDLIQNRIETLNSKMDKLINIQEKVLNRLDGM
CQNIDSIERDMETLKVDKEEIHIPARARTLPPALAQTQGTGMGGEVREMCQEMSSFMTVL
DQRSEKQAEKLDGMEKLVLSIHQVIRFIGETMKSPRVMEMMFMGPAARKASKSKDLKMAI
KRQSSGEKSKSSVTKKTDKPKDHKKKDGKEKSGLSPKGLKAQKKKKPPDTADTISLRKQV
LLLEEVQKLNRENAERSSSSSSGHQQQQHLTPDGFLDLEAGAGGTSEDSLSPNLLDFILE
GPKAPVTEEESLSEEEAAGDGLKMEERKEEEVVKKEEKEHHLNESKEEEKEEELLKTTEK
PEEDRRLEEKEGEKEKEGDTTLSKGPSEAVDMSVKDIPSLPTSPKAPGDTNSIPESCEDH
NKSASSLSLEAAKQDQMEEGSTRSKRQVMEEDLGVEDHKKSRVEEGEEEKKEGERKEEDE
AERPEDEDEGWGVFKADGVDIRVELKKRLGKDQATEVKQSTGEMFFIDKSPPPPAPFNHR
IVSAKPNQINNFYTINRVEVLGGGRFGQVHKCMENCSGLTLASKIIKARSQKEKEVVKNE
ITVMNQLDHANLIQLYAAYESRNDIILVLEYVDGGELFDRIIDENYTLMELDTVMFIREI
CEGLQHMHKMYILHLDLKPENILCVSRVTNKIKIIDFGLARKYKPREKLRVNFGTPEFLA
PEVVNYDYVSFNTDMWSLGVITYMLLSGLCPFLGDNNPETLNNILACQWNFDEEEFTDIS
EEAKDFISKLLIVNKSWRIGASEALRHPWLSDPVLHHRLHEKKNMCNCSRRSSCVPITDS
NT seq 2523 nt   +upstreamnt  +downstreamnt
atgagttccaagatagtgaactataactcaacctcaagaaagccaagcatgatggataac
gtaaccgattgcaatggtgccggcttggacctcattcagaatcgcattgagactctgaac
agtaagatggacaaactcatcaacatccaggagaaggtcctcaaccggctggatggaatg
tgccagaacattgacagtatagagagggacatggaaacactgaaggtggataaggaagag
atccatatccctgccagagcccgaactctaccaccggccctggctcaaacccagggcacg
ggcatggggggcgaagtgagagagatgtgtcaggagatgagctccttcatgacagtgctg
gaccagcgctcggagaagcaggctgagaagctggacggaatggaaaagctggtactcagc
atccatcaggtcatcagattcattggggagacgatgaagagcccccgggttatggagatg
atgtttatgggtccggcagcacgcaaggcctccaagtcaaaagacctcaagatggctatt
aagaggcaatcgtctggagaaaagagcaagagctcagttactaagaagaccgacaagcca
aaagatcacaagaagaaggatgggaaggagaagtcgggtctgagcccgaagggtctgaaa
gcacagaaaaagaagaagcccccagacacagcagataccatctcccttaggaagcaggtg
ttgctactagaggaggttcagaagctcaacagggagaatgcagagagatcatcatcatca
tcatcaggtcaccagcagcagcagcacctcacccctgatggcttcctggacctggaggct
ggagctggagggacctcagaggattccctcagcccaaacctgctggactttatcctcgag
ggccccaaggcccctgtgactgaagaggagtcattgtctgaggaggaggctgcaggagat
ggactaaaaatggaagagaggaaggaggaggaggttgtaaaaaaggaggagaaggaacac
caccttaatgaatcgaaggaagaggagaaagaggaggagctgttgaaaaccacagagaag
cctgaagaggatagaagactagaagaaaaggagggggagaaggagaaagagggggacact
acactctctaaaggcccatcagaagctgttgatatgtcagtaaaggatatcccttctctc
ccaacctcccctaaagctccaggagacactaactccattcccgagagctgtgaagaccac
aacaaaagtgcttcctctctgtctctggaggcagcaaaacaggaccagatggaggagggc
agcaccaggagtaagcgtcaggtgatggaggaagacctgggagtagaggaccacaagaag
agtcgggtagaggaaggagaggaggagaagaaggagggggagaggaaggaggaggacgaa
gcagagagaccagaggatgaggatgagggatggggcgtcttcaaagcagacggggtggat
atccgtgtggagctgaagaagaggctggggaaagatcaggccacagaagtcaagcagtct
acaggggaaatgttcttcattgacaaaagtcctcctccaccagctccattcaaccaccgg
atagtgtcggccaaacccaaccagatcaacaacttctacaccatcaacagagttgaggtt
ctaggagggggtcgttttggccaggtgcacaaatgcatggaaaactgctcaggtctcacc
ctagcttccaaaatcatcaaagcccggagtcagaaagaaaaggaggtggtcaagaatgag
atcacggtcatgaaccagttggaccatgccaacctgatccagctctacgccgcctacgag
tccaggaatgatatcatcctggtgctggaatatgtggatggtggggagctctttgaccgg
atcattgacgagaactacactctgatggagctggacacggtcatgttcatcagggagatc
tgtgagggcctgcagcacatgcacaagatgtacatcctccatctggacctcaagccggag
aatattctatgtgtgagcagagtcacaaataaaatcaagatcattgactttggacttgcc
agaaaatacaagcccagagagaagttgcgagtgaatttcggcaccccagagttcctggcc
ccagaagttgtcaactatgactatgtgtcattcaacaccgacatgtggagtctgggagtc
attacatatatgcttctcagcggtctgtgtcctttcctgggtgacaataaccctgagact
ctgaacaacatccttgcctgccagtggaactttgacgaggaagaatttacagacatctca
gaggaagccaaagacttcatctctaaactactcatcgtcaataaaagttggaggataggt
gcctctgaagcattgaggcatccttggctctctgacccagtcctccatcaccgacttcat
gaaaagaagaacatgtgtaactgctcacggcgatcttcatgcgtacccattacagatagt
tga

KEGG   Salmo salar (Atlantic salmon): 106601032
Entry
106601032         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106601032
   04020 Calcium signaling pathway
    106601032
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106601032
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106601032
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106601032
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106601032
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106601032
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106601032
SSDB
Motif
Pfam: Pkinase I-set PK_Tyr_Ser-Thr Ig_3 Ig_2 ig V-set fn3 C2-set_2 C1-set Kdo Kinase-like Interfer-bind
Other DBs
NCBI-GeneID: 106601032
NCBI-ProteinID: XP_014048371
UniProt: A0A1S3R7N1
LinkDB
Position
ssa03
AA seq 885 aa
MSSDSSPKKRYVSTLRMYIGPTNTSPGQGKNVLAASITSAAATRTGIDTASSTADSCHTL
TPLRSLDPPLFTEPLEDCSADEGSDITLRGVITGSQPISVSWLHNGEAVFFGKPLFDGSE
TRLVVRECLPEDAGAYTCVAENRAGKTSSSAAVCVRDFETICRVLNATSHTSPPLNNNIM
ENRGSKLLLSSNNDSVFRQSSSPISSNTPSPGGPRKVSTEVRPKKRASSGTASLQFKDPP
SHIEARLGETARLTCAFSGSPPVVSCWIRNKEPVVDGSELWVESSDQSSTLVIAEPGPEH
SGRYTVVVRDRKSSAQHSLTLSVIERPQSPASSPVVSLLSVSPLCLVLSWSGPCYDGGSA
VLGYVVEVRRKGPAESGDWSELTARCKSTSYKVRSGLEPQGEYCFRVRAYNVVGVSEPSE
ESPLIKMEQRAEPQEEESPRTYEDVTINSTHKVTDHYNILEKLGVGKFGQVFKLTHKETG
RVCAGKFYKGRRAKEREAARKEIELMNFLHHPKLVQCLGAYDLKPEMVMVMEFIAGGELF
ERIVDDSFVHTEPASVRYMQQIVEGIGYMHQQNIIHLDLKPENIVCVDHTGTRIKIIDFG
LASKLDPSTPLKVMHGTPEFVAPEVIGYEPVSLATDMWSIGVICYILLSGESPFQGNSEA
ETLALVTGAQWEFDEESFEEITDQAKEFISSLLNKEPRRRISCEEALGHSWIAEPISADP
STTKCLSKEKMKRYLARQKWKKTGKALLALKRMALLSKADGPGSSTTPVEDSPLSPEAEQ
ALQSLEVKLQGGPQFSLTLTDQTASQGSNARLSCHLRGYPDPEVVWLRGEEPLEESSRVQ
IEYEEDGLCTLVLAQVGPGDSDVYTCRATNDQGKAQCSAKLIVKE
NT seq 2658 nt   +upstreamnt  +downstreamnt
atgagcagtgacagcagccccaagaagcgctatgtatcaaccctcaggatgtacatcgga
cccaccaacacttcccctgggcagggaaaaaacgtcttggcagccagtatcacttctgct
gctgctactaggactgggatagacacagcctctagtacagcggacagctgccacacacta
acccccctcagaagtctggatccacccctgttcacagagcctttggaggactgctcggcg
gatgaaggaagtgacatcacactccgaggggttatcacaggaagtcagccaatcagtgtg
tcctggctgcacaatggtgaggcagtgttttttgggaagcccctcttcgatggcagtgag
actaggctggtggtgagggaatgcctacctgaggacgcgggtgcctacacctgtgtggca
gagaaccgagcgggcaagacctccagcagcgcagctgtgtgtgtgagagactttgagact
atctgcagagtcctgaacgcaacttcacacacttcccctcccctcaacaacaacattatg
gaaaacagaggctcaaagttactactgtcatccaacaatgacagtgtcttcagacaatcc
agctccccaataagctctaacaccccgagcccaggaggaccccgaaaagtctccacagaa
gtcaggccaaagaagagagccagctccgggacagcctcgttgcagtttaaggatccccca
tcccacattgaggcacgactaggagagacagcccgtctgacgtgtgcgttcagtggaagt
ccccctgtggtgtcctgctggatacgaaataaagaaccagttgtagatgggtctgagttg
tgggtagagagcagtgatcagagcagtacattggtgatcgcagagccaggacctgagcac
tcaggacgctacaccgttgtagtacgagaccgcaagagctcggcgcagcacagcctcact
ctttctgtcatagagcggccccagtccccagcctccagccccgtggtgtctctcctctct
gtctctcctctctgtttggtcctgtcctggtctgggccctgctacgacggaggcagtgct
gtcctaggctacgtggtggaggtgaggagaaaaggccccgctgagtctggggactggagt
gagctcacagcccgttgcaagagtacttcttacaaggtgcgctccgggcttgagcctcag
ggggagtactgcttccgggtgagggcctacaacgtggtgggggtgagcgagcccagtgag
gagtctccgcttatcaagatggagcagagagctgagccacaagaggaggagtctcctcgg
acatatgaggacgtcaccatcaactccacccacaaggtcaccgatcactacaatatactg
gagaaactgggagtggggaagtttggccaggtgttcaaactgactcacaaggagaccggc
cgtgtgtgtgccggaaagttctacaagggccggcgggccaaggagagggaggcggcccgt
aaagagatagagctgatgaacttcctgcaccaccccaaactggtccagtgtctgggggcc
tatgatctcaagccagaaatggtcatggtcatggagttcattgccggaggtgagctgttt
gagcgtatagtggacgacagctttgtgcacacagagccggccagtgtgcgctacatgcag
cagatcgtggaggggatcggctacatgcaccagcagaacatcatccacctggacctgaag
cctgaaaacatagtgtgtgttgaccacactggcacacgaattaagatcattgactttggc
ctggccagcaagctggacccctccactcccctgaaggtgatgcacgggacaccagagttt
gtggctccagaggtgattggctatgagcctgttagcttagctacagacatgtggagcatt
ggagtcatctgctacatattactgagtggcgagtctcccttccagggtaacagtgaggca
gaaaccctggccttggtgactggtgctcagtgggagtttgacgaggagagcttcgaagag
atcactgaccaggccaaagaattcatcagctccctgctcaacaaggaaccaaggcgcagg
atatcctgtgaggaggctctaggccactcctggatagctgagcccatctcagcagacccc
agcaccaccaagtgtctctccaaggagaagatgaagaggtaccttgccaggcagaagtgg
aagaaaacagggaaagccctgctggcgctgaagaggatggctttgctgtctaaagccgat
gggcctggctcctccaccacccctgtagaagacagccccctgagtcctgaggcagagcag
gccctgcagtctctagaggtcaaactccagggggggccccagttctccctgaccctaacg
gaccagactgcctcccagggctctaacgcccgcctctcctgtcaccttagagggtatcct
gacccagaggtggtgtggttgaggggggaggagcctctggaggagtcatcccgggtgcag
atagagtatgaagaggatgggctctgcaccctggtcctggcccaagttgggccaggggac
tcggatgtttacacctgtagggccaccaacgaccaggggaaggcacagtgttcagccaaa
ctcatagtaaaggaatag

KEGG   Salmo salar (Atlantic salmon): 106607302
Entry
106607302         CDS       T04363                                 

Definition
(RefSeq) myosin light chain kinase, smooth muscle-like
  KO
K00907  myosin-light-chain kinase [EC:2.7.11.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04020  Calcium signaling pathway
sasa04270  Vascular smooth muscle contraction
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106607302
   04020 Calcium signaling pathway
    106607302
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106607302
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106607302
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106607302
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106607302
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.18  myosin-light-chain kinase
     106607302
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106607302
SSDB
Motif
Pfam: Pkinase I-set PK_Tyr_Ser-Thr Ig_3 Ig_2 ig V-set fn3 C1-set RIO1 C2-set_2 Kinase-like Interfer-bind Kdo
Other DBs
NCBI-GeneID: 106607302
NCBI-ProteinID: XP_014059609
UniProt: A0A1S3S5K0
LinkDB
Position
ssa06
AA seq 884 aa
MSSDSSPKKRYVSTLRMYIGPTNTSPGQGKNILATSTTSATATRTGIDTASSTGNSCPTP
TPLRGLDPPLFTEPLEDCSADEGSDISLRGVITGSQPISVSWLHNGEAVFFGEPLFDGSE
TRLVVRECLPEDAGAYTCVAENRAGKTSSSAAVCVRDFETICGVLNASSHTSPALNNSIM
ENRGSKLLMSPNNDSVFRQSSSPISSNTPSPGGPQKVSTEVTPKKRASSGTASLQFKDPP
SHIEARLGETARLTCAFSGCPPVVSCWIRNKEPVVDGSELWVESSDQSSTLVIAEPGPEH
SGRYTIVVRDRKSSAQHTLALSVIERPQSPASSPVVSLLSVSPLCLVLSWSGPCYDGGSA
VQGYVVEVRRKGPAESGGWSELTAHCKSTSYKVRSGLEPQGEYCFRVRAYNVVGVSEPSE
ESPLIKMEQRAEPQEESPRTYEDVTIDSTHKVTDHYNVLEKLGVGKFGQVFKLTHKETGR
VCAGKFYKGRRAKEREAARKEIELMNYLHHPKLVQCLGAYDLKPEMVMVMEFIAGGELFE
RIVDDSFVHTEPASVHYMQQIVEGMGYMHQQNIIHLDLKPENIVCVDHTGTCIKIIDFGL
ASKLDPSTPLKVMHGTPEFVAPEVIGYEPVSLATDMWSIGVICYILLSGESPFQGNSEAE
TLALVTGAQWEFDEESFEEITDQAKDFISSLLNKEPRRRISCEEALVHSWIAEPISADPS
TTKCLSKEKMKRYLAKQKWKKTGKALLALKRMALLSKADGPGSPTTPAEDSPLSPEAEQA
LQSLEVKLQGVPQFSLTPTDQTASQGSTARLSCHLTGYPDPEVVWLRGEEPLEESSRVQI
EYEEDGFCTLVLAQVGPEDSDVYTCRATNDQGKAQCSAKLIVQE
NT seq 2655 nt   +upstreamnt  +downstreamnt
atgagcagtgacagcagccccaagaagcgctatgtatcaaccctcaggatgtacatcgga
cccaccaacacttcccctgggcagggaaaaaacatcttggcaaccagtaccacttctgct
actgccactaggactgggatagacacagcctctagtacagggaacagctgccccacacct
acccccctgagaggtctggatccacccctgttcacagagccattggaggactgctcggcg
gatgaaggaagtgacatctcactccgaggggttatcacaggaagtcagccaatcagtgtg
tcctggctgcacaatggtgaggcagtgttttttggggagcccctcttcgatggcagtgag
actaggctggtggtgagggaatgcctacctgaggacgcgggtgcctacacctgtgtggca
gagaaccgagcgggcaagacctccagcagcgcagctgtgtgtgtgagagactttgagact
atctgcggagtcctgaacgcatcttcacacacttcccctgccctcaacaacagcattatg
gaaaacagaggctcaaagttactaatgtcacccaacaatgacagtgtcttcagacaatcc
agctccccaataagctctaacaccccgagcccaggaggaccccaaaaagtctccacagaa
gtcacgccaaagaagagagccagctcggggacagcctcgctgcagtttaaggatccccca
tcccacattgaggcacggctaggagagacagcccgtctgacgtgtgcgttcagtggatgt
ccccctgtggtgtcctgctggatacgaaataaagaaccggttgtagatgggtctgagttg
tgggtagagagcagtgatcagagcagtacgttggtgatcgcagagccaggacctgagcac
tcaggacgctacaccattgtagtacgagaccgcaagagctcggcgcagcacaccctcgct
ctttctgtcatagagcggccccagtccccagcctccagccctgtggtgtctctcctctcg
gtctcgcctctctgtttggtcctgtcctggtctgggccctgctacgacggaggcagtgct
gtccagggctacgtggtggaggtgaggagaaaaggccccgctgagtctgggggctggagt
gagctcacagcccattgcaagagtacttcttacaaggtgcgctccgggcttgagcctcag
ggagagtactgcttccgggtgagggcctacaacgtggtgggggtgagcgagcccagtgag
gagtctccgcttatcaagatggagcagagagctgagccacaagaggagtctcctcggaca
tatgaggacgtcaccatcgactccacccacaaggtcactgatcactacaatgtactggag
aaactgggagtggggaagtttggccaggtgttcaaactgactcacaaggagacgggccgt
gtgtgtgcaggaaagttctacaagggccggcgggccaaggagagggaggcggcccgtaaa
gagatagagctgatgaactacctgcaccaccccaaactggtccagtgtctgggggcctat
gatctcaagccagagatggtcatggtcatggagttcattgccggaggtgagctgtttgag
cgtattgtggacgacagctttgtgcacaccgagccggccagtgtgcactacatgcagcag
atcgtggaggggatgggctacatgcaccagcagaacatcatccacctggacctgaagcct
gaaaacatagtgtgtgttgaccacactggcacgtgcatcaagatcattgactttggcctg
gccagcaagctggacccctccactcccctgaaggtgatgcacgggacaccagagtttgtg
gctccagaggtgattggctatgagcctgttagcttagctactgacatgtggagcattgga
gtcatctgctacatattactgagtggcgagtctcccttccagggtaacagtgaggcagag
accctggccttggtgactggtgctcagtgggagtttgacgaggagagcttcgaagagatc
actgaccaggccaaagacttcatcagctccctgctcaacaaggaaccaaggcgcaggata
tcctgtgaggaggctctggtccactcctggatagctgagcccatctcagcagaccccagc
accaccaagtgtctctccaaggagaagatgaagaggtacctcgccaagcagaagtggaag
aaaacagggaaagccctgctggcgctgaagaggatggctctcctgtctaaagccgatggg
cctggctctcccaccacccctgcagaagacagccccctgagtcctgaggcagagcaggcc
ctgcagtctctagaggtcaaactccagggggtgccccagttctccctgaccccaacggac
cagactgcctcccagggctccaccgcccgcctctcctgtcacctcacagggtatcctgac
ccagaggtggtgtggttgaggggggaggagcctctggaggagtcatcccgggtgcagata
gagtatgaagaggacgggttctgcaccctggtcctggcccaagttgggccagaggactcg
gatgtttacacctgtagggccaccaacgaccaggggaaggcacagtgttcagccaaactc
atagtacaggaatag

DBGET integrated database retrieval system