KEGG   Salmo salar (Atlantic salmon): 106566997Help
Entry
106566997         CDS       T04363                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00030  Pentose phosphate pathway
sasa00051  Fructose and mannose metabolism
sasa00052  Galactose metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
sasa01230  Biosynthesis of amino acids
sasa03018  RNA degradation
Module
sasa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106566997
   00030 Pentose phosphate pathway
    106566997
   00051 Fructose and mannose metabolism
    106566997
   00052 Galactose metabolism
    106566997
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106566997
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106566997
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106566997
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106566997
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106566997
Messenger RNA biogenesis [BR:sasa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106566997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 106566997
NCBI-ProteinID: XP_013991210
UniProt: A0A1S3LJY6
LinkDB All DBs
Position
ssa13
AA seq 776 aa AA seqDB search
MSHTSMDPTKMGIGRSIAVLTSGGDAQGMNAAVRATVRVGIYTGAKVYFVHEGYQGLVDG
GDNIKLATWESVSMMLQLGGTVIGSARCMDFRAREGRMKAALNLVKLGITNLCVIGGDGS
LTGANQFRKEWATLLVDLVKAGKITDDEARKSSHLNIVGMVGSIDNDFCGTDMTIGTDSA
LHRIIEVVDAITTTAQSHQRTFILEVMGRHCGYLALVTALACGADWVFIPEMPPDEGWEG
HLCRRLADQRARGSRLNVIIVAEGAMDRDGNPISSEDIKKLVEKNLGFDTRTTVLGHVQR
GGTPSAFDRILGSRMGVEAVMALLEATPETPACVVSLSGNQAVRLPLMECVQVTKDVTTA
MAEKRWEDAIKLRGKSFENNWNTYKMLAHINPPDTKSNINVAIVNIGAPCAGMNAAVRSA
VRIGIIQGHNMLAVHDGFEGLAQGKIEPITWTGVSGWTGKGGSELGTKRVLPSEYIEEIS
LTIAKFNIHSLVIIGGFEAYMGGLELVQGRDKYEELCIPMVVIPATVSNNVPGSDFSIGA
DTALNTITSTCDRIKQSAAGTKRRVFIIETAGGYCGYLATMAGLAAGADAAYIYEDKFGI
RDLEMNVEHLVQKMKTDVKRGLILRNENCNANYTTDFIFALYSEEGKGIFDCRKNVLGHM
QQGGTPTPFDRNFGTKMGSKAVLWITEKLKEVYRHGRIFANTPDSACVLGMKKRALTFQP
LAELKEQTDFVHRIPKTSWWLKLRPIMKILAKYNISLDTSEHAHMEHVIKKRVSMH
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatacaagcatggatccaaccaagatgggcatcggccggtctatagccgtgctg
acgtctggtggtgatgcccaaggtatgaacgcggccgtgagggccacagtcagagttggt
atctacaccggagccaaggtctactttgttcatgagggttaccagggtctggtggatgga
ggagacaacatcaaactggccacctgggagagtgtgtccatgatgctgcaactgggtggc
acggtcatcggcagtgcccgctgcatggacttcagagccagggagggccgcatgaaggct
gccctgaacctggtcaagctgggcatcaccaacctgtgtgtgattgggggtgacggtagc
ttgaccggagctaaccagttcaggaaggagtgggccactctgctggtcgacctggtcaaa
gccggtaaaattacagatgacgaggcccgtaaatcgtcccacctgaacatcgtaggcatg
gtgggttctatcgacaatgacttctgtgggacagacatgaccatcgggactgactctgct
ctgcaccgcatcatagaggtggtggatgccatcaccactaccgcacagagtcaccagagg
accttcatcctggaggtgatgggtagacactgtggctacctggccctggtgactgctcta
gcctgcggtgctgactgggtgttcatcccagagatgcccccagatgagggatgggagggg
catctgtgcagaagactggctgatcaaagagccagaggatctcgtctgaatgtgattatt
gtggctgagggtgctatggacagagacggaaaccccattagctctgaagacatcaagaag
ctggtggagaagaatttgggctttgacacccgtaccactgtcctgggacacgtgcagaga
ggcggcactccctcagccttcgacagaatcctgggcagcaggatgggtgtggaggctgtg
atggccctgttggaggccactccagagaccccggcctgtgtggtcagtctgtccggtaac
caggccgtcaggctgcccctcatggagtgtgtccaagtgactaaggatgtgaccactgcc
atggctgagaagagatgggaggatgcaatcaagctcagaggaaagagctttgaaaacaac
tggaacacatacaagatgctggcccacatcaaccctccagataccaagagcaacattaac
gtggctatagtaaacattggtgctccatgtgctggtatgaacgctgccgtgcgttctgca
gtgaggatcggcatcattcagggacacaacatgttggccgttcatgacgggttcgagggt
ctcgctcaaggaaagatcgagcctatcacctggactggagtgtcaggctggactggaaag
gggggctctgagttgggcaccaagagagtccttccttctgagtacattgaggaaatcagc
ttgactatcgctaaattcaatatccactctctggtgattattggagggttcgaggcgtat
atgggtggtctggagctggtgcagggcagagataagtatgaagagctgtgcattcccatg
gtggtcatccccgccactgtctccaacaacgtccccggctcagacttcagtatcggcgct
gacacagccctcaacaccatcacctcgacctgtgacaggatcaagcagtcagcagcaggc
accaagcgtcgtgtgttcatcattgagaccgcaggagggtactgtggttacctggctacc
atggcaggtctggctgctggggctgatgccgcatacatctatgaggacaaatttggtatt
agagacctggagatgaatgtagagcatctcgtgcagaagatgaagacagacgtgaagaga
ggtttgattctcaggaatgagaactgcaatgccaactacaccacagactttatcttcgcc
ctctactctgaggagggcaagggcatctttgactgccgcaagaacgtcctgggacacatg
caacagggaggcaccccaacacctttcgacaggaactttggcaccaagatgggttccaag
gctgttttgtggataacagagaaactcaaggaggtctatagacacggtcgtatcttcgct
aacacccctgactctgcctgtgtgctgggcatgaagaagagagcactgactttccagcct
cttgctgagctgaaggaacagacagactttgtgcaccgcatccccaaaacatcgtggtgg
ctgaaactgaggccaatcatgaagatccttgctaaatacaacatcagcctggacacatct
gagcatgcccacatggaacatgttatcaagaagagggtgtcgatgcactga

DBGET integrated database retrieval system