KEGG   Salmo salar (Atlantic salmon): 106567047
Entry
106567047         CDS       T04363                                 

Gene name
dhh
Definition
(RefSeq) desert hedgehog
  KO
K11990  desert hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106567047 (dhh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106567047 (dhh)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106567047 (dhh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 106567047
NCBI-ProteinID: XP_013991352
UniProt: A0A1S3LK60
LinkDB
Position
ssa13
AA seq 476 aa
MKVSSWWVSLAWLGLLAIYTWSSLVQGCGPGPGYGFRHRSRKPTPMPYKTYFPKLSENNL
GASGRSEGKITRNSERFNELVCNYNPDIIFKDEEKTLADRFMTKRCKDCLNKLAIAVMNH
WPGTKLRVTEAWDEDGHHPPDSLHYEGRAVDITTSDRVLDKYGMLAQLAVEAGFDFVYYE
SKHHVHCSVKADHSVAVEKGGCFPAWARVSVAGGGQKTLASLEPGDRVLALSESGRVVLS
RVLLFLHQDHESRSTFLVLTTQDGHRLALTPHHLVFLAPHYELHHSEYQARFASRAKRGD
NVLVHGADGRLQPSRIVSISQEERMGVYAPLTEHGTLFVDGVLASSYALIEDHRLAHWAF
GPLRLLLSVIQLVRGEGTQGAQVTEAEREHTKTPTHCNTHQKSLRVWGNQKLSSPGVYVN
TNTSDRQSNWTSVPINRDIEGGNCDSVRDKVLSVHWYARLLHRLGQICLDPETFHP
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaaggtgtcctcctggtgggtaagcctggcatggcttggcctgctcgccatctacaca
tggagctccctggtccaggggtgcgggccaggccctgggtacggcttccgccataggtcc
aggaaacccacccccatgccttacaagacctacttccccaaactttctgagaacaacctg
ggtgccagtgggaggtcagagggaaagatcacacgcaactcagaacgctttaatgaactg
gtgtgtaactacaaccctgatatcatcttcaaagatgaggagaaaactcttgctgaccga
ttcatgaccaagcgctgtaaggactgcctcaacaagctggccatagcggtgatgaaccac
tggcctgggacgaagctgagggtgacagaggcctgggatgaggacggccatcacccccct
gactctcttcactatgaggggagggccgtggacatcaccacgtcggaccgcgtcctggac
aagtacggcatgctagcccagctggctgtggaggctggcttcgactttgtgtactatgag
tccaagcaccacgtgcactgctctgtcaaagctgatcactcagtggcagtggagaaaggg
ggctgtttccctgcctgggcccgggtgagtgtagccggaggcggacagaagaccctggcg
tccctggagcctggagacagagtgttggccctgtctgagtcaggacgcgtcgtcctcagc
cgtgtccttctttttttacaccaggaccatgagagcaggtccactttcctcgtcctgacc
acacaagatggccaccgccttgccctcactccccaccacctggtcttcctggccccccat
tacgaactccaccacagtgagtaccaggctcggttcgccagtagagcaaaacggggagac
aatgtactcgtccatggagcagacggtcgactacaaccatctcggattgtttcgatatca
caggaggaaaggatgggagtttacgcacccctgactgaacacggcactctgtttgtggat
ggggtgctggcatccagctatgcacttatagaggaccatagactggcacactgggcattt
gggcctctgagactgctgctctcggtcatccagctagttcggggggagggcacacagggg
gcgcaggtcacagaagcagagagagagcacacgaagacgcccactcactgcaacactcac
cagaagagcctgagagtttgggggaatcagaaactcagcagcccaggcgtgtatgtgaat
acaaacacttccgacagacaaagtaattggacctctgtacccataaacagagacattgag
ggagggaactgtgactccgtgcgagataaagttctgagtgtgcactggtatgctaggctg
ctacaccggcttggacagatctgtctagacccggagacatttcatccctaa

KEGG   Salmo salar (Atlantic salmon): 106569233
Entry
106569233         CDS       T04363                                 

Definition
(RefSeq) tiggy-winkle hedgehog protein-like
  KO
K11988  sonic hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106569233
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106569233
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106569233
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106569233
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Morphogens
   106569233
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Hint_2 Intein_splicing Hom_end_hint
Other DBs
NCBI-GeneID: 106569233
NCBI-ProteinID: XP_013995868
UniProt: A0A1S3LY80
LinkDB
Position
ssa14
AA seq 415 aa
MDVMLILIRIALVGFICLFLASDGLACGPGKGYGKQRHPKKLKPLAYKQFIPNVAEKTLG
ASGKYEGKITRNSERFKDLTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNQW
PGVKLRVTEGWDEDGHHLEESLHYEGRAVDITTSDRDKSKYGMLSRLAVEAGFDWVNYES
KAHIHCSVKAENSVAAKSGGCFPGSASVLLEDGRSKLVKELEVGDKVLAADIEGNIVSSD
FLMFLDQDPVSRREFYVFETEKPNRKLRLTPAHLVFITNNVTDDDMTAVFASNVKPGQQV
FVMDEAVDHLKAVTVERIYVEEYEGSYAPVTSQGTIIVDHVLASCYAVIEDHKWAHWAFA
PVRFGHALMSFTGLVKKREDIRQRDGIHWYSDILYHIGTLLLDINSFHPLGMSQS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggacgtgatgcttatactgataagaattgcgctcgtgggcttcatctgcctgtttcta
gcatccgatgggttggcctgtggtccaggcaagggatatggaaaacaaagacatccgaaa
aaactgaagcctttggcttacaagcagttcattcccaacgtggcggagaagacccttggg
gccagtggcaaatacgaagggaagatcacaaggaactctgaaagatttaaagacctgaca
ccaaactacaatcctgacattattttcaaagatgaggaaaacactaatgctgacagactt
atgacacagagatgtaaggacaaactgaactctttggcgatttcagtcatgaatcagtgg
ccgggagtgaagctgcgcgtgacagaaggctgggacgaggatggacaccatttggaagaa
tctttacactatgaaggaagggctgtggatatcaccacctctgacagagataagagcaaa
tatggaatgttatcccggctcgcggtggaggcaggattcgactgggtcaattatgaatcc
aaagcccatattcattgttctgtgaaagcagaaaattcagttgctgcaaagtcgggtggc
tgcttccctggatctgcctcagttctcctcgaggatgggcgaagcaagctggtaaaagaa
ctggaggtgggcgacaaggtgttagcagcagacatagaaggaaatattgtgtccagcgat
ttcctcatgttcttggaccaagatccagtgtcaagacgagaattttatgtttttgaaaca
gagaagcccaaccgaaagttaagactgacgccggctcacctggtcttcatcaccaataac
gttacggatgacgacatgactgcagtgtttgccagtaatgtaaaacctgggcaacaggtg
tttgttatggacgaggccgtagaccacctgaaggcagtcactgtggaaaggatttacgtg
gaagaatacgagggatcttatgccccagtaacctcacaaggaaccatcatagttgaccat
gttttggcgagctgttacgcggtaatcgaggaccacaaatgggcgcactgggcctttgcg
ccagtccggtttgggcacgcgttgatgtccttcacaggtctagtcaaaaagcgcgaggac
atacgtcagagagatggaatacactggtactcagacattttataccacatagggacattg
ctgctggacataaactcctttcatcctcttggaatgtcccaaagctga

KEGG   Salmo salar (Atlantic salmon): 106573850
Entry
106573850         CDS       T04363                                 

Definition
(RefSeq) sonic hedgehog protein A-like
  KO
K11988  sonic hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106573850
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106573850
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106573850
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106573850
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Morphogens
   106573850
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint Intein_splicing Hom_end_hint
Other DBs
NCBI-GeneID: 106573850
NCBI-ProteinID: XP_014004725
UniProt: A0A1S3MNR2
LinkDB
Position
ssa16
AA seq 418 aa
MLLPRLVVCLAGCAVILSQVSEGCGPGRGYGKRRSPRKLAPLAYKQFSPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPGV
RLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYAMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGTSSVTLKDGSRKAVKDLRVGDKVLAANSDGNLAYSDFIM
FVDQDSATRRVFYVLETKEPAQKIILTAAHLLFVVNNSTDDLHSMSAVFASKVKPGQKVV
VFDDLHSQLKSVTVERIYTEEHEGSFAPVTVQGTIVVDQVLASCYAVIEDHNLAHLAFAP
VRMSYWLSSLRSPKDYSMPNATLHEDGVHWYSKILYQLGTWLLDSHALHPLGMSINSS
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgctactccccaggctcgtggtgtgcctcgccgggtgcgcagtgattctctcgcaggtc
agcgagggctgcgggccgggaaggggatatggcaagaggaggtcaccgaggaagctcgcg
ccacttgcctacaagcagttcagccctaacgtagccgagaagacactaggtgcgagtggt
cgatatgaggggaaaataacacggaactcggagcgcttcaaagagctgaccccgaactat
aaccctgacatcatctttaaagatgaagagaacacaggtgcagaccggatgatgacacag
cgctgcaaggacaagctgaactctctggccatctcggtgatgaacctgtggccgggggtg
cgcctccgggtcacagagggctgggacgaggacggccaccattctgaggagtcgctccac
tacgagggacgggcggtcgacatcacgacctctgaccgcgaccgcaacaagtacgccatg
ttggctcgactggcagttgaggccggcttcgactgggtctactacgagtccaaggcccac
atccactgttctgtcaaagcagaaaactctgttgctgccaaatcaggaggctgcttccca
ggcacctcttcggtaactctcaaagatggaagcaggaaggcagtgaaagacctcagagtt
ggcgacaaagtgctggcagccaacagtgatgggaacctcgcatatagtgacttcatcatg
ttcgtggaccaggactctgcaaccagaagagtgttttatgtgctagagactaaagaacca
gcccagaaaatcatccttactgctgcacatctgctctttgtggtcaacaactcaacggat
gatctccacagcatgtcagcagtatttgcgagcaaagtcaaacctggacaaaaggtggtc
gtctttgatgatttgcatagccaactgaagtcggtcaccgtggaacggatttacacggag
gagcacgaggggtcatttgcgcctgtgacggttcaaggaaccatcgtggtagatcaggtg
cttgcgtcatgttacgcggtaattgaagaccacaatctagcgcacctggcgtttgcacct
gtcagaatgagctactggctgtcctcgttgcgatccccgaaagactactccatgcccaac
gccaccttacacgaggacggagtgcactggtactccaaaattctatatcaattaggaacg
tggctcttggatagccacgcgcttcacccactggggatgtcaataaactcaagttga

KEGG   Salmo salar (Atlantic salmon): 106574860
Entry
106574860         CDS       T04363                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106574860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106574860
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106574860
SSDB
Motif
Pfam: Hint Intein_splicing
Other DBs
NCBI-GeneID: 106574860
NCBI-ProteinID: XP_014006452
UniProt: A0A1S3MTF1
LinkDB
Position
ssa16
AA seq 245 aa
MIYQEEHSVAAKSGGCFPGGAWVTLEDGGQRLIQELQPGERVLASSGSDGSGELVYSEVL
TFLDRDPATRKEFYTIRTEGGVSLSLTAAHLLFVSEGNCSEGAEPTPGSMRTVYASDVRP
GQCVLTTVSGEGVGKGEEGRKGVGHLSRISRVSVQEDKGVFAPLTRHGTLSVNGMVASCY
AVVDGHDLAHRAFAPLRLLHRWTGSAGGHFGDTGVHWYSQLLYWIGSLLLDSGHFHPWGL
ADPGR
NT seq 738 nt   +upstreamnt  +downstreamnt
atgatttaccaagaagagcactccgttgccgctaaatcaggggggtgttttccgggaggg
gcgtgggtgaccctagaggatgggggtcaaaggttgatccaggagctgcagccgggtgag
cgagtcctcgcctcttcagggagcgacggcagtggagagctcgtttacagcgaggtcctc
accttcctggaccgcgaccccgcaacccggaaggaattctacaccattaggacagaaggc
ggggttagcctgtcactcaccgctgcccacctgctgttcgtgtccgagggaaactgctct
gaaggggcggagccaactcctggtagtatgaggacggtatacgccagcgacgtgcggccg
ggacagtgtgtgctaaccacagtgtctggggagggggttggaaagggggaggaggggaga
aaaggcgtggggcatctctcgcgcatctcccgggtgagtgtgcaggaggacaagggcgtg
tttgcacccctcacccgccatgggacgctgtcagtgaacggcatggtggcatcgtgctac
gcggtggtggacgggcatgacctcgcccacagagccttcgccccgctgcgcctgctgcac
cgttggactggctccgctggcggacattttggagacaccggggttcactggtactcccag
ttgctgtactggataggcagtctgctgctggactctggacacttccatccctggggactg
gctgacccagggaggtga

KEGG   Salmo salar (Atlantic salmon): 106575859
Entry
106575859         CDS       T04363                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106575859
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106575859
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106575859
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Peptidase_M15_4
Other DBs
NCBI-GeneID: 106575859
NCBI-ProteinID: XP_014008036
UniProt: A0A1S3MZ68
LinkDB
Position
ssa17
AA seq 427 aa
MLLPRLVVCLAGCAVILSQVSEGCGPGRGYGKRRSPRKLAPLAYKQFSPNVAEKTLGASG
RYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRMMTQRCKDKLNSLAISVMNLWPGV
RLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYAMLARLAVEAGFDWVYYESKAH
VHCSVKSEHSVAAKSGGCFPGGAWVTLEDGGQRLIQELQPGERVLASSGSDGSGELVYSE
VLTFLDRDPATRKEFYTIRTEGGVSLSLTAAHLLFVSEGNCSEGAEPTPGSMRTVYASDA
RPGQCVLTTVSGEGVGKGEEGRKGVGHLSRISRVSVQEDKGVFAPLTRHGTLSVNGMVAS
CYAVVDGHDLAHRAFAPLRLLHRWTGSAGGHFGDTGVHWYSQLLYWIGSLLLDSGHFHPW
GLADPGR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgctactccccaggctcgtggtgtgcctcgccgggtgcgcagtgattctctcgcaggtc
agcgagggctgcgggccgggaaggggatatggcaagaggaggtcaccgaggaagctcgcg
ccacttgcctacaagcagttcagccctaacgtagccgagaagacactaggtgcgagtggt
cgatatgaggggaaaataacacggaactcggagcgcttcaaagagctgaccccgaactat
aaccctgacatcatctttaaagatgaagagaacacaggtgcagaccggatgatgacacag
cgctgcaaggacaagctgaactctctggccatctcggtgatgaacctgtggccgggggtg
cgcctccgggtcacagagggctgggacgaggacggccaccattctgaggagtcgctccac
tatgagggacgggcggtcgacatcacgacctctgaccgcgaccgcaacaagtacgccatg
ttggctcgactggcagttgaggccggcttcgactgggtctactacgagtccaaggcccac
gtgcactgcagcgtgaagtcggagcactccgttgccgctaaatcaggggggtgttttccg
ggaggggcgtgggtgaccctggaggacgggggtcaaaggttgatccaggagctgcagccg
ggtgagcgagtcctcgcctcttcagggagcgacggcagcggagagctcgtttacagcgag
gtcctcaccttcctggaccgcgaccccgcaacccggaaggaattctacaccattaggaca
gaaggcggggttagcctgtcactcaccgctgcccacctgctgttcgtgtccgagggaaac
tgctctgaaggggcggagccaactcctggtagtatgaggacggtatacgccagcgacgcg
cggccgggacagtgtgtgctaaccacagtgtctggggagggggttggaaagggggaggag
gggagaaaaggcgtggggcatctctcgcgcatctcccgggtgagtgtgcaggaggacaag
ggcgtgtttgcacccctcacccgccatgggacgctgtcggtgaatggcatggtggcatcg
tgctatgcggtggtggacgggcatgacctcgcccacagagccttcgccccgctgcgcctg
ctgcaccgttggactggctccgctggcggacattttggagacaccggggttcactggtac
tcccagttgctgtactggataggcagtctgctgctggactctggacacttccatccctgg
ggactggctgacccagggaggtga

KEGG   Salmo salar (Atlantic salmon): 106578610
Entry
106578610         CDS       T04363                                 

Definition
(RefSeq) sonic hedgehog protein A-like
  KO
K11988  sonic hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106578610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106578610
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106578610
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106578610
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Morphogens
   106578610
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Hom_end_hint Vint
Other DBs
NCBI-GeneID: 106578610
NCBI-ProteinID: XP_014013081
UniProt: A0A1S3ND80
LinkDB
Position
ssa19
AA seq 421 aa
MDEMLLLTRIVLVGLICLSLVSSGMGCGPGRGYGRRRHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQW
PGVKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGTASVTLKDGSRKAVKNLRVGDKVLGANSDGDLAYSD
FIMFMDQDSSTRRVFYVIETKEPAQKITLTAAHLLFLVNNSTDDLHSMSAVFASKVKPGQ
KVVVFDDLLNQLKSVTVGRIYMEEHEGSFAPVTVQGTIVVDQVLASCYAVIEDHNLAHWA
FAPVRLSYWLSSLLSPKDYSMPNATLHEDGVHWYSKILYQLGTWLLDSHALHPLGMSINS
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgctgttgacgagaatcgttctggtcgggttaatctgcttgtccttg
gtgtcctctgggatgggctgtggaccgggcaggggctacggtaggagaagacatccgaag
aagctgacacctcttgcgtacaaacagttcatcccaaacgtcgcggagaagaccctaggg
gccagtggcagatacgaaggcaagatcacgcggaactccgagcgatttaaagaactgact
cccaattacaatactgacattatctttaaggatgaagagaacaccggtgcggaccggctc
atgactcagagatgtaaagacaagctgaactccctggctatctctgtcatgaaccagtgg
ccaggggtaaagctccgcgtcaccgagggctgggacgaggatgggcaccatttcgaagag
tcgctacactacgagggaagggcagtggatatcacgacctccgatagagacaagagcaaa
tacggcacgctgtccagactagcggtggaggctgggttcgactgggtctactacgagtcc
aaggcccacatccactgctctgtcaaagcagaaaactcagttgctgccaaatcaggcggc
tgcttcccaggcaccgcttcggtgactctcaaagatggaagcaggaaggcagtgaaaaac
ctcagagttggcgacaaagtgctaggtgccaacagtgatggggacctcgcatacagcgac
ttcatcatgttcatggaccaggactcgtcaactagacgagtattttatgtgatagagact
aaagaaccggctcagaaaattacccttactgctgcacatctcctcttcttggtcaacaac
tcaacggatgatctccacagcatgtcagcagtatttgcgagcaaagtcaaacctggacaa
aaggtggttgtctttgatgatttgcttaaccaactgaagtcggtcaccgtgggacggatt
tacatggaggagcacgaggggtcctttgctccggtgactgttcaaggaaccatcgttgtt
gatcaggtgcttgcgtcatgttacgcggtaattgaagaccataatctagcgcactgggcg
tttgcacctgtcagactgagctactggctgtcctcgttgctatccccgaaagactactcc
atgcccaacgccaccttacatgaggacggagtgcactggtactccaaaattctatatcaa
ttaggaacgtggctcttggatagccacgcgcttcacccactggggatgtcaataaactca
agttga

KEGG   Salmo salar (Atlantic salmon): 106582516
Entry
106582516         CDS       T04363                                 

Gene name
ihh
Definition
(RefSeq) indian hedgehog
  KO
K11989  indian hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106582516 (ihh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106582516 (ihh)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106582516 (ihh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 106582516
NCBI-ProteinID: XP_014021167
UniProt: A0A1S3P0K9
LinkDB
Position
ssa21
AA seq 424 aa
MRLSVLVGLFIGCALLLAPVTEGCGPGRGYGKRRPPKKLTPLAYKQFSPNVAEKTLGASG
KHEGKITRNSERFKELTPNYNPDIIFKDEENTAADRLMTQRCKDKLNSLAISVMNMWPGV
KLRVTEGWDEDGHHSEDSLHYEGRAVDITTSDRDRNKYSMLARLAVEAGFDWVYYESKAH
VHCSVKSEHSVAAKTGGCFPGRSLVTLDDGSSRAVQDLQPGDRVLASSGADGSRSGGDLV
YSEFFTFLDHEPAARKQFYVLGTETGANLTLTAAHLVFVTEGNCSLGELAKGAVMRTMYA
SDVRPGQCVLTAGRNQGLQGNLSQVIWVHIQMDTGAFAPLTRHGSLVVDGVLASCYAAMD
QHHLAHWAFGPLRLLYSWTRWTGTGASLGDGLHWYSQVLYWIGTFLLDPGHFHPWGMVTH
DSER
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcgtctctccgtgcttgtagggctcttcatcggttgcgccctgcttctcgcacctgta
accgagggctgtgggccggggaggggatatggcaagagacgtccgccaaagaagctcaca
cccctcgcttataagcagttcagcccaaacgttgccgagaaaacactgggcgccagtggc
aaacacgaggggaaaataacgagaaattcagaacggttcaaagagctcactcccaactat
aaccctgatatcatatttaaagatgaggagaatacggctgccgatcgacttatgacccag
cgttgtaaagacaagctgaactccctggccatctctgtgatgaacatgtggcctggggtg
aagctgagagtgacagaaggctgggacgaggacgggcatcactcagaggactcgctccat
tatgagggaagagcggtggacatcaccacctcagaccgggacaggaacaagtactccatg
ctggctcgcctggccgtggaggctggcttcgactgggtttactatgaatccaaggcacac
gtgcactgcagtgtcaagtcagagcactcagtagcagctaagaccgggggctgtttccct
ggtcgttctctggtcactctggatgatgggagcagcagagcggttcaggacctccagcca
ggtgaccgggtcctggcctcctcaggggctgacggcagcaggagcggaggagacctcgta
tacagtgagttcttcaccttcctggaccacgagcctgcagccaggaaacagttctacgtg
ttgggaacagagacgggagcaaacctgaccctcaccgcggctcatcttgtgttcgtgacc
gagggtaactgttcactgggcgaattggccaagggtgctgtcatgcggactatgtacgct
agcgacgtacggccaggacagtgtgtgctgactgcagggagaaaccagggacttcaggga
aacctctcccaagtcatttgggtccacatccagatggacaccggggccttcgcccccctg
acacgccacgggtcactggtggtggacggcgttctagcctcgtgctacgctgctatggac
cagcaccacctagctcactgggcctttggtcccctccgcctgctctacagctggaccaga
tggaccgggactggtgcctctctaggagacggactacactggtactcacaagtcctgtat
tggataggaacattcctattggaccctggacatttccacccctgggggatggtcacgcat
gactcagagagataa

KEGG   Salmo salar (Atlantic salmon): 106586914
Entry
106586914         CDS       T04363                                 

Definition
(RefSeq) indian hedgehog B protein-like
  KO
K11989  indian hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106586914
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106586914
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106586914
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 106586914
NCBI-ProteinID: XP_014030135
UniProt: A0A1S3PR04
LinkDB
Position
ssa25
AA seq 419 aa
MRRSVLVGLFMGCTLLLAPVTECCGPGRGYGKRRPPKKLTPLSYKQFSPNVAEKTLGASG
RHEGKITRSSERFKELTPNYNPDIIFKDEENTAADRLMTQRCKDKLNSLAISVKNMWPGV
TLRVTEGWDEDGHHSEDSLHYEGRAVDITTSDRDRNKYAMLARLAVEAGFDWVYYESKAH
VHCSVKSEHSVAAKTGGCFPGRSLVTLEDGSSRAVQDLQPGDRVLASSGAGGSGGELVYS
EFLTFLDHEPAARKQFYVLGTETGANLTLTAAHLVFVTESNCSVGEPSKGAVMRTMYASD
VRPGQCVLTAGRDKGPQAHLSPVAWIHIQMNTGAFAPLTRHGSLVVDGVLASCYAAMDQH
HLAHWAFGPVRLLYSWTGLGTMQGDGLHWYSRVLHWIGKFLLDPGHFHPWGVVTHDVER
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcgtcgctccgtgcttgtgggcctcttcatggggtgcaccctgctgctcgcacctgta
acggagtgctgtgggccggggaggggatatggcaagagacgtccgccgaagaagctcaca
cccctctcttataagcagttcagcccaaacgttgcggagaaaacactgggcgccagtggc
agacatgaagggaaaataacgagaagttcagaacggttcaaagagctcactcccaactat
aaccctgatattatatttaaagatgaggagaatacggctgccgatcgacttatgacccag
cgttgtaaagacaaactgaactccttggccatctctgtgaagaacatgtggcctggggtg
acgctgagagtgacagagggctgggacgaggacgggcaccactcagaggactccctccat
tatgagggaagagcggtggacatcaccacgtctgaccgggacaggaacaaatacgccatg
ctggctcgcctggccgtggaggccggcttcgactgggtgtattacgagtccaaggcccac
gtgcactgcagtgtcaaatcagagcactcagtagcagctaagaccgggggttgtttcccg
ggtcgttctctggtgacgctggaagacgggagcagcagggcggttcaggacctccagcca
ggtgaccgtgtcctggcctcctcaggggctggtgggagtggaggagagcttgtctacagt
gagttcctcaccttcctggaccacgagcctgcagccaggaaacagttctacgtgttggga
acagagacgggagcaaacctgaccctcaccgcggctcatcttgtgttcgtgactgagagc
aactgttcagtgggggaaccgtccaagggggctgtcatgcggactatgtacgccagcgat
gtacggccaggacagtgtgtgctgactgcagggagagacaagggaccacaagcccacctc
tccccagtcgcctggatccacatccagatgaacaccggggccttcgcccctctgacacgc
catgggtcactggtggtggacggcgttttagcctcgtgctacgctgctatggaccagcac
cacctagctcactgggcctttggtcccgtacgcctgttgtacagctggactgggctgggg
acaatgcaaggagacggactacactggtactcacgggtcctgcattggataggaaagttc
ctactggaccctggacacttccacccctggggggtggtcacgcatgatgtggaaagatag

KEGG   Salmo salar (Atlantic salmon): 106590104
Entry
106590104         CDS       T04363                                 

Gene name
shh
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106590104 (shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106590104 (shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106590104 (shh)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106590104 (shh)
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Morphogens
   106590104 (shh)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint Intein_splicing Hom_end_hint
Other DBs
NCBI-GeneID: 106590104
NCBI-ProteinID: XP_014036145
UniProt: A0A1S3Q847
LinkDB
Position
ssa29
AA seq 421 aa
MDEMLLLTRIVLVGLISLSLVSSGMGCGPGRGYGRRKHPKKLTPLAYKQFIPNVAEKTLG
ASGRYEGKITRNSERFKELTPNYNTDIIFKDEENTGADRLMTQRCKDKLNSLAISVMNQW
PGIKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKSKYGTLSRLAVEAGFDWVYYES
KAHIHCSVKAENSVAAKSGGCFPGTSSVTLKDGSRKAVKDLRVGDKVLAANSDGNLAYSD
FIMFVDQDSATRRVFYVLETKEPAQKIILTAAHLLFVVNNSTDDLHSMSAVFASKVKPGQ
KVVVFDDLHSQLKSVTVERIYTEEHEGSFAPVTVQGTIVVDQVLASCYAVIEDHNLAHLA
FAPVRMSYWLSSLRSPKEYSMPNATLHEDGVHWYSKILYQLGTWLLDSHALHPLGMSINS
S
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggacgaaatgctgctgttgacaagaatcgttctggtcgggttgatctccttgtccttg
gtgtcctctgggatgggttgtggaccgggcaggggctacgggaggagaaaacatccgaag
aagctgacacctcttgcgtacaagcagttcatcccaaacgtcgcggagaagaccctaggg
gccagtggaagatacgaaggcaagatcacgcggaactccgagcgatttaaagaactgact
cccaattacaatactgacattatctttaaggatgaagagaacaccggtgcggaccggctc
atgactcagagatgtaaagacaagctgaactccctggctatctccgtcatgaaccagtgg
ccagggataaagctccgcgtcaccgagggctgggacgaggatgggcaccatttcgaagag
tccctacactacgagggaagggcagtggatatcacgacctccgatagagacaagagcaag
tacggcacgctgtccagacttgcagtggaggctggattcgactgggtctactacgagtcc
aaggcccacatccactgttctgtcaaagcagaaaactctgttgctgccaaatcaggaggc
tgcttcccaggcacctcttcggtaactctcaaagatggaagcaggaaggcagtgaaagac
ctcagagttggcgacaaagtgctggcagccaacagtgatgggaacctcgcatatagcgac
ttcatcatgttcgtggaccaggactctgcaaccagaagagtgttttatgtgctagagact
aaagaaccagcccagaaaatcatccttactgctgcacatctgctctttgtggtcaacaac
tcaacggatgatctccacagcatgtcagcagtatttgcgagcaaagtcaaacctggacaa
aaggtggtcgtctttgatgatttgcatagccaactgaagtcggtcaccgtggaacggatt
tacacggaggagcacgaggggtcatttgcgcctgtgacggttcaaggaaccatcgtggta
gatcaggtgcttgcgtcatgttacgcggtaattgaagaccacaatctagcgcacctggcg
tttgcacctgtcagaatgagctactggctgtcctcgttgcgatccccgaaagaatactcc
atgcccaacgccaccttacacgaggacggagtgcactggtactccaagattctatatcaa
ttaggaacgtggctcttggatagccacgcgcttcacccactggggatgtcaataaactca
agttga

KEGG   Salmo salar (Atlantic salmon): 106599328
Entry
106599328         CDS       T04363                                 

Definition
(RefSeq) tiggy-winkle hedgehog protein-like
  KO
K11988  sonic hedgehog
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106599328
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106599328
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106599328
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   106599328
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Morphogens
   106599328
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Hint_2 Intein_splicing Hom_end_hint
Other DBs
NCBI-GeneID: 106599328
NCBI-ProteinID: XP_014045977
UniProt: A0A1S3R293
LinkDB
Position
ssa03
AA seq 415 aa
MDMMLMSIRLALVGFICLSLVSAGFACGPGRGYGKRRHPKKLKPLAYKQFIPNVAEKTLG
ASGKYEGKITRNSERFKDLTPNYNPDIIFKDEENTNADRLMTQRCKDKLNSLAISVMNQW
PGVKLRVTEGWDEDGHHFEESLHYEGRAVDITTSDRDKNKYGMLSRLAVEAGFDWVNYES
KAHIHCSVKAENSVAAKSGGCFPGSASVLLEDGQSKLVKELEVGDKVLAADKEGHIVSSD
FLMFMDRDPVTSREFYVFETEKPNRKLRLTPAHLVFVTNNVTDGDMTAVFASNVKPGQQV
FVVDEALDHLKAVTVERIYVEEYEGSYAPVTSQGTIIVDHVLASCYAVIEDHKWAHWAFA
PVRLGHSLMSLTGLVKEREEIPQRDGIDWYSDILYHIGTFLLDRNSFHPLGMSQS
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggacatgatgctgatgtcgataagacttgcgcttgtgggcttcatctgcctgtcttta
gtatccgctggtttcgcctgtggtccaggtaggggatatggaaaacgaagacatccgaaa
aaactgaagcctttggcttacaagcagttcattcccaacgtggcagagaagacccttggg
gccagtggcaaatacgaagggaagatcacaaggaactctgaaagatttaaagacctgaca
ccaaactacaatcctgacattattttcaaagatgaggaaaacactaatgctgacagactt
atgacacagagatgtaaggacaaactgaactcgttggctatttcagtcatgaatcagtgg
ccgggagtgaagctgcgggtgacagaaggctgggacgaggatggacaccatttcgaggaa
tctttacactatgaaggaagggctgtggatatcaccacctctgacagagataaaaacaag
tatggaatgttatcccggctcgcggtggaggcgggattcgactgggtcaattatgaatcc
aaagcccatattcattgttctgtgaaagcagaaaactcagttgctgccaaatcgggtggc
tgcttcccaggatccgcctcagttcttctcgaggatggtcagagcaagctggtaaaggaa
ctggaggtgggcgacaaagtgttagctgcagacaaagaaggacatattgtatctagcgat
ttccttatgttcatggacagagatccagtaacaagtcgagaattttatgtttttgaaacg
gagaagcccaacagaaagttaagactgacgccggcacaccttgtcttcgtcaccaataac
gttacagatggcgatatgactgcagtgtttgccagtaatgtaaaacctgggcaacaggtg
tttgtcgtggacgaggcactagaccacctaaaggcagtcactgtggaaaggatttacgtg
gaagaatacgagggatcgtatgccccagtgacttcacaaggaaccatcatagttgaccat
gttttggcgagctgttacgcggtaatcgaggaccacaaatgggcgcactgggcctttgca
ccagtccggttgggtcactcgttgatgtctttgacaggtctagtcaaagagcgcgaggaa
atccctcagagagatggaatagactggtactcagacattctataccacatagggacattt
ctgctggacagaaactcctttcatcctcttggaatgtcacaaagttga

DBGET integrated database retrieval system