KEGG   Salmo salar (Atlantic salmon): 106567147
Entry
106567147         CDS       T04363                                 

Definition
(RefSeq) caspase-9-like
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04370  VEGF signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106567147
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106567147
   04115 p53 signaling pathway
    106567147
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106567147
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106567147
   01002 Peptidases and inhibitors [BR:sasa01002]
    106567147
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     106567147
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106567147
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106567147
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 106567147
NCBI-ProteinID: XP_013991583
UniProt: A0A1S3LM38
LinkDB
Position
ssa13
AA seq 456 aa
MEERHKRILQRNRVNLVRDLNPSDMYDGLLSKGIFTQDMIDEIKRSGTRRDQARQLVRDL
ETRGSRAFPALIECLREKGQHSLPDLLLAGEPQSQPLPLPVHVRPVVRPLPVYSHMDTVV
TPVYPSQPVRPLPITPVYPSQPVRPLPTPTTPSLSPEREFGKPRAPGRVRRDSSIQSYKM
DASPCGHCLIINNVDFEPQSELNNRTGSNIDCDKLERRFKSLNFIVLVKRNLKQKQIRQE
LSALSKKDHSQYDCCVVIMLSHGTEVSHNRFPGAVHGVDGPNVPVQLITNYLNGQNCPSL
QGKPKLFFIQACGGGERDTGFEVTPDEDKPCIGGTDDQTDAMPMSSSSDSLSTPSDEPDT
RATLPTPSDILVSYSTFPGYVSWRDTQAGSWYVETLDNILEDNAAANDLVTMLMMVNHEV
SQNSAKGLYKQMPGSFNFLRKLLYFQVPPCQRPIQA
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggaggagagacacaaaaggattctccaacgcaatagggtcaatctcgtgagagacctg
aacccatcagatatgtatgatggacttctgtcaaaaggaatctttactcaagacatgatc
gacgagataaagagatcaggaaccagacgagaccaagccagacagttggttcgagacctg
gagactcgtgggagtcgggcattcccagctttaatagagtgccttcgtgagaaagggcag
cacagcctaccagatctcctcttggcgggggaaccacagagccagcctctacctctgcct
gtccatgtccggccagtcgttaggcctttgccagtttactctcatatggacactgtagta
acccctgtctatccaagtcaaccagttaggcctttgcctattacccctgtctatccaagt
caaccagttaggcctttgcctacgcctaccactcccagtttatcccctgaaagggagttt
ggaaaacccagggcaccaggaagagttagacgtgacagcagtattcagagttataagatg
gatgccagcccctgtggacactgcctgatcataaacaatgtcgattttgagcctcagtca
gagctgaataaccgcacagggtccaacatagactgcgacaaactggagagaagatttaaa
tcccttaactttattgtccttgtcaagagaaacctgaaacagaagcaaataaggcaggag
ctatcagctttgtccaagaaggatcattcacaatatgattgttgtgtggtgatcatgtta
tcacatgggacggaggtaagtcacaatcgcttccctggtgcagtgcatggagtggacggg
cccaatgtcccagttcagctcatcacaaactacctcaatggtcagaactgcccttcccta
cagggcaagcccaagctcttctttatccaggcctgtgggggaggtgagagagacacaggc
tttgaggtgactcctgacgaggataagccttgtattggaggaacagatgaccagacggac
gccatgcccatgtcctccagcagtgactctctgagcactccgtctgatgagccagacact
agggccacactgcccacacctagcgacatactggtgtcctactccaccttcccaggttac
gtctcctggagagatacacaagctggctcctggtatgtagaaacactggataacatctta
gaagacaatgctgccgctaatgacctggtcaccatgttaatgatggtaaaccatgaagtt
tcacaaaactcagccaaaggcctctacaaacagatgcctggttcctttaactttctacgc
aaacttctctactttcaagtcccaccctgccagagaccaatccaggcatga

KEGG   Salmo salar (Atlantic salmon): 106572551
Entry
106572551         CDS       T04363                                 

Gene name
casp9
Definition
(RefSeq) caspase 9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04370  VEGF signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106572551 (casp9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106572551 (casp9)
   04115 p53 signaling pathway
    106572551 (casp9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106572551 (casp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106572551 (casp9)
   01002 Peptidases and inhibitors [BR:sasa01002]
    106572551 (casp9)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     106572551 (casp9)
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106572551 (casp9)
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106572551 (casp9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 106572551
NCBI-ProteinID: XP_014002303
UniProt: A0A1S3MGV4
LinkDB
Position
ssa15
AA seq 450 aa
MEERHKRILQRNRVNLVRDLNPSDMYHGLLSEGIFTQDMIDEIKSSGIRQDQARQLVRDL
ETRGSLAFPALIECLHETGQHSLAELLLDGEPQNQPLPQSVHVRPVVRPLPVYSPMDTVK
PVQVVTPVYPTQSVKAMPTTPIPCTVARKTPEREFGKPRATGRVRRDSIQSYKMDANPCG
HCLIINNVDFEPKSELSKRTGSNIDCEKLERRFKSLNFIVLVKRNLKQKQIKQELSALSK
KDHSQYDCCVVIMLSHGTEVCNNRFPGAVHGVDGPNVPVQHITNYLNGQNCLSLQGKPKI
FFIQACGGGERDTGFEVSPDEARPCIGGTGDQTDAMPMSSSSDSLSTQSDEPDAKATLPT
PSDILVSYSTFPGYVSWRDTQAGSWYVETLDNILEENAATDDLVTMLMMVSHEVSENSAN
GLYKQMPGSFNFLRKLLYFQALPCQRPILS
NT seq 1353 nt   +upstreamnt  +downstreamnt
atggaggaaagacacaaaaggattctccaacgcaatagggtcaatctcgtgagagacctg
aacccgtcagatatgtatcatggacttctgtcagaaggaatctttactcaagacatgatc
gacgagataaagagctcagggatcagacaagaccaggccaggcagttggttcgagacctg
gagacccgcgggagtctggcgttcccagctttaatagagtgccttcacgagacagggcag
catagtttagcagagctcctactggatggagaaccacagaaccagcctctacctcagtct
gtccatgtccggccagtcgttaggcctttaccagtttactcacctatggacactgtcaag
cctgttcaagtggtaacccctgtctatccaactcaatcagtgaaggctatgcccaccaca
cccattccatgtacagtggcaagaaaaacccctgaaagggagtttggaaaacccagggca
acaggaagagttagacgtgacagtattcagagttataagatggatgccaacccctgtgga
cactgcctgatcataaacaatgtcgattttgagcctaagtcggagctgagtaagcgcaca
gggtccaacatagactgtgaaaaactggaaagaagattcaaatctctgaactttattgtt
cttgtcaagagaaacctgaaacaaaagcaaataaagcaggagctttcggctttgtccaag
aaggatcattcacagtatgactgctgtgtggtgatcatgttatcacatgggacggaggtg
tgtaacaatcgcttccccggtgcagtgcatggagtggatgggcccaatgtcccagttcag
cacattaccaactacctgaacggtcagaactgtctttccctacagggcaagccaaagatc
ttcttcatccaggcctgtgggggaggtgagagagacacaggctttgaggtgtctcctgac
gaggcaaggccttgtattggaggaacaggtgaccagacagacgcaatgcctatgtcctcc
agcagtgactctctgagcactcagtctgatgagccagacgcaaaggccacactacccaca
cccagcgacatactggtgtcctactccaccttccccggttacgtctcctggagagatacc
caggctggctcctggtatgtagagacactagataacatcttagaagagaatgctgccact
gatgacctggtcaccatgttaatgatggtaagccatgaagtttcagaaaactcggccaac
ggcctctacaaacagatgcctggttcctttaactttctacgcaaacttctctacttccaa
gccctgccctgccagagaccaatcctgtcatga

DBGET integrated database retrieval system