KEGG   Salmo salar (Atlantic salmon): 106567336
Entry
106567336         CDS       T04363                                 

Definition
(RefSeq) protein reprimo A-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106567336
SSDB
Motif
Pfam: Tmemb_9 DUF2448
Other DBs
NCBI-GeneID: 106567336
NCBI-ProteinID: XP_013991946
UniProt: A0A1S3LM36
LinkDB
Position
ssa13
AA seq 108 aa
MDVAGKILNKTVSEEEHSGFDTVRVCCNVSAAAAVITDNGFGASHPEEHDLFIMRVVQIA
VLCVLSLTVIFGIFFLGCNLLIKTESMISLFVEDRRPSTDNDMIMVAS
NT seq 327 nt   +upstreamnt  +downstreamnt
atggatgtcgccgggaaaatactgaataaaacagtgtccgaagaagagcactcaggattt
gacactgtgcgtgtatgctgcaacgtttcagcagcagcagcagttatcaccgacaatgga
ttcggtgcgtctcatccagaggaacatgacctcttcataatgcgtgtggtgcagatcgcg
gtcctgtgcgtattgtcactcactgtgatttttggcatatttttccttggttgcaatctt
ctaattaaaacagaaagtatgatcagtctttttgtagaagaccggagaccgtctacggac
aatgatatgatcatggttgcctcatag

KEGG   Salmo salar (Atlantic salmon): 106581827
Entry
106581827         CDS       T04363                                 

Definition
(RefSeq) protein reprimo A-like
  KO
K10128  reprimo, TP53-dependent G2 arrest mediator candidate
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106581827
SSDB
Motif
Pfam: Tmemb_9
Other DBs
NCBI-GeneID: 106581827
NCBI-ProteinID: XP_014019683
UniProt: A0A1S3NWA8
LinkDB
Position
ssa21
AA seq 94 aa
MNSTAFNQTDSAGLFNKTEDIFCCNFSSVVTDNGFVAATPDERSLFLMRVVQIAVMCVLS
LTVVFGIFFLGCNLLIKSEGMINFLVTDRRPSKE
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaattctaccgctttcaatcaaacggacagtgcaggacttttcaataagactgaagat
atattttgctgtaacttttcatcagtggtgactgataatggcttcgtggcggcgactccg
gatgagagaagtctctttctcatgagagttgtccagatagcagttatgtgcgtgttatcg
ctcacggtggttttcggtatattctttttgggctgcaatcttctcatcaagtcagaggga
atgatcaactttttggtgacggacagaagaccatccaaagagtga

DBGET integrated database retrieval system