KEGG   Salmo salar (Atlantic salmon): 106567492
Entry
106567492         CDS       T04363                                 

Definition
(RefSeq) glucocorticoid receptor-like
  KO
K05771  glucocorticoid receptor
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106567492
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106567492
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:sasa03310]
    106567492
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    106567492
Nuclear receptors [BR:sasa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   106567492
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 106567492
NCBI-ProteinID: XP_013992257
UniProt: A0A1S3LMR8
LinkDB
Position
ssa13
AA seq 781 aa
MDNQDKSLERGEEGSFSVNAGSSKSTTLTSVMHLPGSTPQPPASDSSNGLNVTKIQGELS
TAGTASIGLPIEEAEVKLMDKALRMQNAQKQQQNHQQLFENFALLEESISDLNRSNTPGS
SVLACSNYLFPLKTEDFSPMDKDRLDMGTVSFGQSLKDLDVNERLLGDNTLDILRDLDLP
GSLSDLNEFYLADEAAFLSSLSVDDALLGDGNMETKPIVSSSGGNCKNVNGADQQQLGPG
ISMPVIKTEKDADTSFIQLYTPGVIKQENERQSYCQISSLDIPGTHSSVGSMSGPSYHYG
ANTSTAVSVQQDQKPVFGLYPPLPSVSDSWNRGQEFGDGSGMSTPSSSSFPVSFSSPTAR
PEASSSTSSAPAKHSGPTHKICLVCSDEASGCHYGVLTCGSCKVFFKRAVEGWRARQNTD
GQHNYLCAGRNDCIIDRIRRKNCPACRFRKCLQAGMNLEARKNKKLIRFKGQQATTEPNS
PAPDERACTLIPKSMPQLVPTMLSLLKAIEPEAIYSGYDSTIPDTSTRLMTTLNRLGGQQ
VVSAVKWAKSLPGFRNLHLDDQMTLLQCSWLFLMSFGLGWRSYQQCNGGMLCFAPDLVIN
DERMKLPYMTDQCEQMLKISTEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIR
MTYIKELGKAIVKREENSSQNWQRFYQLTKLLDSMQEMVGGLLQICFYTFVNKSLSVEFP
EMLAEIITNQIPKFKDGSVKPLLFHHALNHDNALKPQPPLSPARPTCFPCRRPTRSPTST
D
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggataaccaggacaagagcttagagagaggtgaagagggaagcttctcggttaacgca
ggcagttccaagtccaccacattaacttccgtgatgcatttgcctggctccacaccccag
cctccagccagcgactcctctaacggactgaatgtcactaagattcagggtgagctctcc
acagcagggacagcctccattggactccctatagaggaggctgaagtaaagttaatggac
aaggccctgagaatgcagaacgcacagaaacagcagcagaatcatcagcagctgtttgag
aactttgctctgttggaggagagcatttcagatttgaatcgatccaacaccccagggagc
tccgtacttgcatgttctaattaccttttccctctgaaaacggaagacttttcaccaatg
gataaggacaggcttgacatggggacagtcagctttggacagtcactgaaggacttggat
gtcaacgagaggctccttggtgacaatacactggacattctgcgggatttggacttgcct
ggctctctgtctgacctgaatgagttttacctggctgacgaggccgctttcctttcctcc
ctgtcagtggatgatgccctgctcggtgacggcaacatggaaaccaagcccatagtcagt
agcagtgggggaaactgtaaaaatgtgaatggcgcagatcagcagcaactgggcccaggg
atctccatgcctgtcatcaagacagagaaggatgctgacacctccttcatccagctttac
accccaggggtaatcaagcaggagaacgagcgccagagctactgtcagatatccagcctg
gacatacctggtacccacagctcggtgggctccatgagtgggccgagttaccactacggc
gcaaacacatcgacggcagtcagcgtacaacaggatcagaagcctgtctttggcctgtat
ccgccgctgccctcagtcagtgacagctggaacagaggccaggaatttggggatggatca
gggatgtcaactccatccagctcatcttttcctgtcagcttcagcagtccaacggccaga
cccgaggccagcagctccacatcttcagcccctgccaagcacagcggtccaacccataag
atctgcctggtgtgttctgacgaggcctctggctgccactatggagtcctcacctgcgga
agctgcaaggtcttcttcaagagggccgttgaaggatggagagcacgacaaaacacagat
ggacaacacaactatctgtgtgccgggaggaatgactgcatcatagacaggatccgcagg
aagaactgtccggcgtgccgcttccgcaagtgtctccaagcagggatgaacctggaagca
aggaaaaacaagaagctgatccgatttaaaggtcagcaggccacgacagagccgaacagt
cccgcacctgacgaaagggcctgcaccttgatcccaaagtccatgccccagctggtgccc
accatgctgtccctgcttaaagccatcgagccagaggccatttactctggctacgacagc
accatccccgacacctccacccgccttatgaccaccctcaacaggttgggcggacagcag
gttgtttcagccgtcaagtgggccaagtccctaccagggttccggaaccttcacctggat
gatcagatgactctgctgcagtgctcctggctgttcctcatgtcattcggcctgggctgg
cgctcctaccagcagtgtaacgggggcatgctgtgcttcgcccctgacctggttattaat
gacgagaggatgaagctgccctatatgactgaccagtgtgagcagatgctgaagatctcc
actgagtttgtgaggttgcaggtgtcctacgacgagtacctgtgtatgaaagtcctgctg
ctgctcagcacagtaccaaaggatggattgaagagccaggctgtgtttgatgagatccgc
atgacctacatcaaggagctgggtaaggccatcgtcaagcgggaagagaactccagccag
aactggcagaggttctaccaactcactaagctactggactccatgcaggagatggtgggg
ggcctcctgcagatctgcttctacacttttgtgaataaatcccttagtgtggagttccct
gagatgctggccgagatcatcaccaaccagataccaaaattcaaagatgggagtgtcaag
ccgcttctgtttcatcatgccttaaaccatgacaatgccttaaaaccccagcctcccctc
tcgccagccagacccacctgttttccctgcagacgtcccaccaggtcacctaccagtacg
gattaa

DBGET integrated database retrieval system