KEGG   Salmo salar (Atlantic salmon): 106567842
Entry
106567842         CDS       T04363                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106567842
SSDB
Motif
Pfam: PA26 CMD Tho2
Other DBs
NCBI-GeneID: 106567842
NCBI-ProteinID: XP_013993115
UniProt: A0A1S3LQL5
LinkDB
Position
ssa13
AA seq 486 aa
MSFSADSTSPNPFHMCNICQKVIRKKEKGVRVPRPFSSGPSAFIPKEEIVEASQVDPLTE
QLLAEAYSPLGHVDHLTQVMGLHPHYLESFLHSQFYLLRMDGPLPLHCRHYIAIMAAARH
QCSFLVSLHVREFYRMGVCLDWLKGLQYIPQRLRNLNEINKLLAHRPWLITKEHIQNLVK
TGEHSWSLAELVHAVVILAHFHALASFVFGSGINPQVDTQNANGFQAVYISNYCTCDLAS
DHHLDRDLSSTSPETTDSVSELEALMDRMKRLQQEREEDEASQEEMATRFEKEKKESLLV
GSGDLEDEVMPTSKVSQFVEDATFGYQDFARRGEDNPPTFRAQDYSWEDHGFSLVNRLYS
DIGLLLDDKFRTACDLTYYNMASHEDVDTTMLRRALFNYVHCMYGIRYDDYDYGEVNQLL
ERSLKVYIKTVTCYPERTTRRMYDSYWRQFRHSEKIVLQDCCSSFGRSCLHQSHIQPFAV
VVPPQS
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgagcttcagtgcggactccacctcccccaacccatttcacatgtgtaacatctgtcaa
aaggtgataaggaaaaaggagaaaggagtcagagtgccgcgacccttctccagtggaccc
agtgccttcattccaaaggaagagattgtggaggcgtcccaagtggaccccctcacagag
cagctcctagccgaggcctactctccgttgggccatgtggaccacctgacccaggtgatg
ggactgcacccccactacctggagtccttcctgcacagccagttctacttgctgaggatg
gacggccccttgcctctccactgccgacactacatcgccatcatggctgcagcgcgtcac
cagtgttccttcctggtgtctctgcatgtgcgtgagttctacaggatgggggtgtgtctg
gactggctgaagggcctgcagtacatccctcagagactgaggaacctcaacgagatcaac
aagctcctagcacacagaccttggctcatcaccaaggagcacattcagaacttggtgaag
acaggggagcacagttggtctttggcagagctggtccatgctgtggtcatattagcccat
ttccatgccctggccagctttgtgtttggcagtggcatcaacccccaggtggacacacaa
aacgccaacggcttccaggccgtctacatcagcaactactgtacatgtgacctggcaagc
gaccatcacctggaccgagatctcagcagtaccagccctgagaccacagactcggtcagt
gagttggaggcgctgatggatagaatgaagaggctgcagcaggagagagaggaggatgag
gcctcgcaggaggagatggccacacgcttcgagaaggagaagaaagagagcctactggtg
ggctctggagatttggaggatgaggtgatgcccacatccaaagtgtctcagtttgtggaa
gatgccaccttcgggtaccaggactttgctcgacgcggggaagacaatccaccaaccttt
agagcacaggactactcgtgggaggaccatggtttctctctggtcaacaggctttattca
gacatcgggctgctgctggatgacaagttccggacagcgtgtgacctgacctactacaac
atggccagtcacgaggacgtggacaccaccatgctccgacgtgcactcttcaactacgtg
cactgcatgtatggcatcagatatgatgactatgactatggggaggtgaatcagctattg
gaacgcagcctgaaggtctatataaagacggtaacatgttatccagagaggaccacgcgt
cgcatgtacgacagctactggagacagttccgtcactccgagaagattgtgcttcaggat
tgttgtagtagttttgggaggtcgtgccttcatcaaagccacattcagccatttgccgtc
gtcgtccccccccaaagctaa

KEGG   Salmo salar (Atlantic salmon): 106571802
Entry
106571802         CDS       T04363                                 

Definition
(RefSeq) sestrin-1-like
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106571802
SSDB
Motif
Pfam: PA26 CMD VDE HD_4
Other DBs
NCBI-GeneID: 106571802
NCBI-ProteinID: XP_014000737
UniProt: A0A1S3MC36
LinkDB
Position
ssa15
AA seq 488 aa
MRHATAATETMENNSFTVTDLYKICTHCERLSKKDLGVSIPRPLGNGPSRFIPEKEILQV
SKVDPRVQSIFEDAFAALGRLDNISLVMGFHPQYLESFLRTQHYLLQMDGPLSLHYRHYI
GIMAAARHQCSYLVNLHVNDFLQVGGDPKWLNGLDGAPQKLQALGELNKILAHRPWLLTK
AHIEHLLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGITPEIHSDGGHTFRPVSLSQ
YCVCDIANGNGHGNDLEERRGSHQVSGEVEVLIERMKQLQECRDEEEASQEEMATRFERE
KTESMLVATAEDEECVQSRDVSRHFEDPSYGYKDFSRRGEHVPTFRVQDYSWEDHGYSLV
NRLYPDVGQLLDEKFQMAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDYDYGE
INQLLDRSFKVYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYAL
RAITCYMT
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaggcacgcaactgcagcaacagaaaccatggaaaataattcatttacagtaacagac
ttatataaaatatgcactcattgtgaacggcttagcaaaaaggacttaggagttagtatc
ccaagaccactgggaaatggaccaagtagatttatccctgaaaaagagatacttcaagtc
agtaaagtagatccgagggtgcaatcgatatttgaggacgcatttgctgcactgggtcgt
cttgacaacatctccttggtgatgggcttccacccacagtacctggagagtttcctgaga
acacagcactacctgctgcagatggatgggcccttatccctgcactaccgccactacata
ggcatcatggctgcggccagacaccagtgctcctacctggtcaacctccacgtcaacgac
ttcctccaggtgggaggggaccccaagtggctgaatggcctggacggagccccacagaag
ctgcaggctcttggggagctcaacaagatcctggcccaccggccctggcttcttaccaag
gcacacattgagcacctgctgaaggctgaagaacacagctggtccctggctgagctgatc
catgctgtggtgctcctcacacactaccactccctggcatcctttaccttcggctgtggc
atcacccctgagatccacagtgatggtgggcacaccttcagacctgtctccctcagccag
tactgtgtctgcgacatcgccaatggcaatgggcacggcaacgacctggaggaaaggaga
ggcagccatcaggtgtctggtgaggtggaggtgttgattgagagaatgaagcagctgcag
gagtgtcgtgatgaagaggaagccagtcaggaggagatggccacacgcttcgagagggag
aagaccgagagcatgctggtggccacggcagaggacgaggagtgtgtgcagtcaagagac
gtgtccaggcactttgaagaccccagctacggctacaaggacttttccaggagaggagaa
catgtacccaccttcagagtacaggactacagttgggaggaccacggctactccctggtg
aaccgtctgtaccctgatgttggtcagctgctggatgagaagttccagatggcctacaac
ctgacctacaacaccatggccatgcacaaagacgtggacacctccatgctccgcagggct
atctggaactacatccactgcatgttcggcatcaggtatgatgactatgactatggggag
attaaccagctgttagaccgcagctttaaggtctacattaagaccatggtgtgcagcccg
gagaaaaccaccaaacgaatgtatgagagcttctggaggcagttccagcactccgagaag
gtccatgtaaatctgcttcttatggaagcgcgcatgcaggcagaactgctctacgctctg
agagcgatcacctgctacatgacatga

KEGG   Salmo salar (Atlantic salmon): 106603373
Entry
106603373         CDS       T04363                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106603373
SSDB
Motif
Pfam: PA26 CMD Tho2
Other DBs
NCBI-GeneID: 106603373
NCBI-ProteinID: XP_014052432
UniProt: A0A1S3RKU3
LinkDB
Position
ssa04
AA seq 483 aa
MNVSAESFTSNPFHICNICQKVIRKKEKGVSVPRPFSSGPSAFIPEEEIVEASQVDPQTE
QILAEAYSLSGHVDHLTQVMGLHPHYLESFLRSQFYLLRMDGPLPLHCRHYIAIMAAARH
QCSFLVSLHVREFYRMGMCLDWLKGLQYAPQRLRNLNEINKILAHRPWLITKEHIQNLVK
TGEHSWSLAELVHAVVILAHFHSLASFVFGSGINPQVDPQHANGFQSVYISDYCTCDLAS
DHHLDRDLSSTSPVTTDSVSELEALMDRMKRLQEEREEDEASQEEMATRFEKEKKESLLV
GSGDMKDEVMPTSKVSRFVEDATFGYQHFARHGEDNPPTFRAQDYSWEDHGFSLVNRLYS
DIGLLLDDKFRTACDLTYYNMASHEDVDTTMLRRALFNYVHCMYGIRYDDYDYGEVNQLL
ERSLKVYIKTVTCYPERTTRRMYDSYWCQFRHSEKVHVNLLLMEARMQAELLYTLRAITR
YMT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaacgtcagcgcggagtctttcacctccaacccatttcacatctgtaacatctgtcag
aaggtgataaggaaaaaggagaaaggagtcagcgtgccgcgacccttctccagtggaccc
agtgccttcattccagaagaggagattgtggaggcgtcccaggtggacccccaaacagag
cagatcctggccgaggcctactctctgtcgggccacgtggaccatctgacccaggtgatg
ggactgcacccccactacctggagtccttcctgcgtagccagttctacctgctgaggatg
gacggccccttgcctctccactgccgacactacattgccatcatggctgcagcgcgtcac
cagtgttccttcctggtgtctctgcatgtgcgtgagttctacaggatggggatgtgtcta
gactggctgaagggtctacagtacgcccctcagagactgaggaacctcaacgagatcaac
aagatcctagcacacaggccctggctcatcaccaaagagcacattcagaacttggtgaag
acaggggagcacagttggtctttggcggagctggtccatgctgtggtcatattggcccat
ttccattccctggccagctttgtgtttggcagtggtatcaacccccaggtggatccacag
catgccaatggcttccagtccgtttacatcagtgactactgtacatgtgacttggccagc
gaccatcacctggaccgagacctcagcagcaccagccccgtaaccacagactcggtcagt
gagttagaggcactgatggacagaatgaagaggctgcaggaggagagagaggaggatgag
gcctcgcaggaggagatggccacacgcttcgagaaagagaagaaagagagcctcctggtg
ggctctggggatatgaaggatgaggtgatgcccacatccaaagtgtctcggtttgtagag
gatgccacctttgggtaccagcactttgctcgacacggagaggacaacccaccaacattt
agagcgcaggactactcgtgggaggaccatggtttctctctggtcaacaggctttattca
gacatcgggctgctgctggatgacaagttccggacagcgtgtgacctgacctactacaac
atggccagtcacgaggacgtagacaccaccatgctccgacgtgcactcttcaactatgtg
cactgcatgtatggcatcaggtatgatgactatgactatggggaggtgaatcagctattg
gaacgcagtctgaaggtctatataaagacggtaacatgttatccagagaggaccactcgc
cgcatgtacgacagctactggtgccagttccgccactccgagaaggtccatgtgaaccta
ctcctaatggaggccaggatgcaggcagaactgctatacaccctgcgcgccatcacacgc
tacatgacctga

KEGG   Salmo salar (Atlantic salmon): 106604703
Entry
106604703         CDS       T04363                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106604703
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 106604703
NCBI-ProteinID: XP_014055103
UniProt: A0A1S3RS61
LinkDB
Position
ssa05
AA seq 445 aa
MIIFMKEMDYPLRNQCQRVQNQVTKVNAEKERVSLRCMKALASRGGVDAVSQQMASHPQY
LESFLRTQHYILHMDGPLPLEYRHYIAIMAAAQHHCGYLVSLHSAQFLRVGGDPLWLQGL
EAVPPRLQHLDQLNKVLAHQPWLTARSHIQALLKTGEQCWSLAELVQAVVLLAHCHSLSS
FVFGSGTDADPVPPHIAPNGTPPGYCLCDAANGNVSAPPPLATPSEHTTRRRSLDSSCEM
VCLKERIQKSQEEKERRGECVLHNQTLQHTDVEDEEEMIYSADPSRFITDPAFGYQEFAR
REEDHFQVFRVQDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVTALPSSHGPDLKRAIWNY
IHCMLGIRYDDYDYGEVNQLLEREIKLYIKSVACYPDATKTPLCPLPWAPLKPSERIHVN
LLIMEARLQAELLYALRAITQYMIA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatcatctttatgaaagaaatggattaccctctcagaaaccaatgtcagcgcgtccag
aaccaggtgacgaaggtgaacgctgagaaggagcgggtgtcgctgcggtgcatgaaggct
ctggccagcagggggggtgtggacgccgtgtcccagcagatggcctctcacccccagtac
ctggagagcttcctccgcacccagcactacatcctccacatggacggccccctgcccctg
gagtaccgccactacatcgccattatggctgcagcgcagcatcactgtggctacctggtg
tctctgcactcggcccagttcctcagggtggggggggacccgctgtggctacaggggctg
gaggccgtcccccctcgcctgcaacaccttgaccaactcaacaaggttctggcccaccaa
ccctggctcaccgcccgctcacacatacaggcgttgctgaagacgggggagcagtgctgg
tctctggctgagctggttcaggctgtggtgctgctggcccactgccactccctctctagc
tttgtgtttggctctggcaccgacgctgaccccgtccccccccacatagcccccaacggc
acccccccgggctactgcctctgtgacgctgccaacggcaatgtcagcgcgcctccgcct
ctcgccacaccctcagagcacaccacacgacgacggtctctggactccagttgtgagatg
gtgtgtctgaaagagaggatccagaaatcccaggaggagaaagagagaagaggggagtgc
gtcctacacaaccagacactccagcacacagatgtggaagatgaggaggagatgatctac
tcggcagacccctctcgtttcataacagaccccgcgttcggctaccaggagtttgcccgg
agggaggaagaccacttccaagtattccgggtgcaggactactcctgggaggaccacggc
ttctccctggtgaaccggctgtactcggacatcgggcacctgctggacgaccgtttccgc
agcgtcacggcgctcccctcatcccacgggcctgacctgaagagagccatctggaactac
atccactgcatgttgggaattaggtacgacgattatgactacggggaggtaaaccagttg
ctggagagggagattaagctttatatcaagtctgtggcctgctaccctgacgccaccaag
accccgctgtgtcccctgccctgggcaccactcaaaccttctgagaggatccatgtgaac
ttgcttataatggaggctcggttacaggctgagcttctgtatgctctgagagccatcacc
cagtacatgatagcttag

KEGG   Salmo salar (Atlantic salmon): 106607965
Entry
106607965         CDS       T04363                                 

Gene name
sesn1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106607965 (sesn1)
SSDB
Motif
Pfam: PA26 CMD VDE
Other DBs
NCBI-GeneID: 106607965
NCBI-ProteinID: XP_014060974
UniProt: A0A1S3S9F5
LinkDB
Position
ssa06
AA seq 549 aa
MDIQDQDATARWEALGSRDARSRGTAMEHISQEVMRRVESIGPIPATVPSPLATAGHPTS
DLNDILARLLMLSKRCPFDDVRERCVWLLQNVQDFGVRIPRPLGNGPSRFIPEKEILQVS
KVDPRTQSIFEDAFAALGRLDNISLVMGFHPQYLESFLRTQHYLLQMDGPLSLHYRHYIG
IMAAARHQCSYLVNLHVNDFLQVGGDSKWLNGLDGAPQKLQALGELNKILAHRPWLLTKA
HIEHLLKAEEHSWSLAELIHAVVLLTHYHSLASFTFGCGITPEIHSDGGHTFRPPSLSQY
CVCDIANGNGHGHLEERRGNHQVSEVSGEVEVLMERMKQLQECRDEEEASQEEMATRFER
EKTESMLVATAEDEECVPSRDVSRHFEDPSYGYKDFSRRGEHVPTFRVQDYSWEDHGYSL
VNRLYPDVGQLLDEKFQMAYNLTYNTMAMHKDVDTTMLRRAIWNYIHCMFGIRYDDYDYG
EINQLLDRSFKVYIKTMVCSPEKTTKRMYESFWRQFQHSEKVHVNLLLMEARMQAELLYA
LRAITRYMT
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggacatccaggatcaggatgccacagccagatgggaggctctgggcagccgtgacgcg
agatccagaggcacagcaatggagcacatcagccaggaagtgatgcggagagtggagagt
atagggccgataccagccaccgtcccctcgcctctagctactgcagggcaccccaccagc
gacctgaatgacatcctggcccgtctactcatgctgtccaagcggtgccctttcgatgac
gtcagagagcgatgtgtttggctgctgcagaacgttcaggactttggagttcgaatccca
agacccctgggaaatggaccaagtagatttatccctgaaaaagagatccttcaagtcagt
aaagtagaccccaggacacaatcgatatttgaggacgcattcgcagcactgggtcgcctt
gacaacatctctttggtgatgggcttccacccacagtacctggagagctttctgaggaca
cagcactacctgctgcagatggacgggcccttatccctgcactaccgccactacataggc
atcatggctgctgccagacaccagtgctcctacctggtcaacctgcacgtcaacgacttc
ctccaggtgggaggggactccaagtggctgaatggcctggacggagccccacagaagctg
caggccctcggggagctcaacaagatcctggcccaccggccctggctcctcaccaaggca
cacatcgagcacctgctgaaggctgaagaacacagctggtccctggctgagctgatccat
gctgtggtgctcctcacacactaccactccctggcctcctttaccttcggctgtggcatc
acccccgagatccacagtgacggggggcacaccttcagacccccctccctcagccagtac
tgcgtctgcgacattgccaatggcaacgggcacggacacctggaggagaggagaggcaac
caccaggtgtcggaggtgtctggtgaggtggaggtgctgatggagaggatgaagcagctg
caggagtgtcgtgatgaagaggaagcaagtcaggaggagatggccacacgctttgagagg
gagaagaccgagagcatgctggtggccacggcagaggacgaggagtgcgtgccatccaga
gacgtatccaggcactttgaagaccccagctacggctacaaggacttctccaggagagga
gaacatgtacccaccttcagagtgcaggactacagttgggaggaccacggctactccctg
gtgaaccgtctgtaccctgacgttggtcagctgctggatgagaagttccagatggcctac
aacctgacctacaacaccatggccatgcacaaggacgtggacaccaccatgctgcgcagg
gccatctggaactacattcactgcatgtttggcatcaggtatgatgactatgactacggg
gagattaaccagctgttggaccgcagctttaaggtctacattaagaccatggtgtgcagc
ccggagaagaccaccaaacgaatgtacgagagcttctggagacagttccagcactccgag
aaggtccatgtgaatctgcttcttatggaagcacgcatgcaggcagaactgctctacgct
ctgagagcgatcacccgctacatgacatga

KEGG   Salmo salar (Atlantic salmon): 106611768
Entry
106611768         CDS       T04363                                 

Definition
(RefSeq) sestrin-3-like
  KO
K10141  sestrin 1/3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106611768
SSDB
Motif
Pfam: PA26 CMD
Other DBs
NCBI-GeneID: 106611768
NCBI-ProteinID: XP_014067798
UniProt: A0A1S3STW9
LinkDB
Position
ssa09
AA seq 445 aa
MIICTKKMDYPLGTQCQRVQNQVIKVNAEKERASLRCMKALASKGGVDAVSQQMASHPQY
LESFLRTQHYILHMDGPLPLQYRHYIAIMAAARHHCGYLVSLHSAHFLRVGGDPLWLQGL
EAVPPRLQHLDQLNKVLAHQPWLTARSHIQALLKTGEQCWSLAELVQAVVLLAHCHSLCS
FVFGSGTDTDPVPLPRAPNGTPPGYCLCDAANGNVSVPQPLTSPSEHTTRRRSLDSSCEM
VCLKERIQKSQEEKERRGEHLLHTQTLQHTDVEDEEEMTYSADPSRFITDPEFGYQEFAR
REEDHFQVFRVQDYSWEDHGFSLVNRLYSDIGHLLDDRFRSVTALPSSHGPDLKRATWNY
IHCMLGIRYDDYDYGEVNQLLEKELKLYIKSVACYPDATKTPLCPLPWAPLKPSERIHVN
LLIMEARLQAELLYALRAITQYMIA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgatcatctgtacgaaaaaaatggattaccccctcggaacccaatgtcagcgcgtccag
aaccaggtgataaaggtgaacgctgagaaggagcgggcgtcgctgcggtgcatgaaggct
ctggccagcaaggggggtgtggacgccgtgtcccagcagatggcctctcacccccagtac
ctggagagcttcctccgtacccagcactacatcctccacatggacggccccctgcctctg
cagtaccgccactacatcgccatcatggctgcagcacggcatcactgtggctacctggtg
tctctgcactctgcccatttcctcagggtggggggtgacccgctgtggctacagggactg
gaggccgtccctcctcgcctacaacaccttgaccaactcaacaaggttctggcccaccaa
ccctggctcaccgcccgctcacacatacaggcgttgctgaagacgggagagcagtgctgg
tctctggctgagctggttcaggctgtagtgctcctggcccactgccactccctctgtagc
tttgtttttggctcgggcactgacaccgaccccgtcccccttcccagagcccccaacggc
acccccccgggctactgcctctgtgacgctgccaacggcaacgttagcgtgccgcagcct
ctcacctcgccctcagaacacacaacacgacgacggtctctggactccagctgtgagatg
gtgtgtttgaaagagaggatccagaaatcccaggaggagaaggagaggaggggggagcat
cttttacacacccagacactgcagcacacagatgtggaagatgaggaggagatgacctac
tccgcagacccctctcgtttcataacagaccctgagtttggctaccaggagtttgcccgt
agagaggaagaccacttccaagtgttccgggtgcaggactactcctgggaggaccacggc
ttctccctggtgaaccggctgtactcggacatcgggcacctgctggacgaccgtttccgc
agcgtcacggcgctcccctcgtcccacgggcctgacctgaagagagccacctggaactac
atccactgcatgttggggattaggtacgacgattatgactacggggaggtaaaccagttg
ctggagaaggagctgaagctttatatcaagtctgtggcctgctaccctgacgccaccaag
accccgctgtgtcccctgccctgggcaccactcaaaccttctgagaggatccatgtgaac
ttgcttataatggaggctcggttacaggctgagcttctgtatgctctgagagccatcacc
cagtatatgatagcttag

DBGET integrated database retrieval system