KEGG   Salmo salar (Atlantic salmon): 106567894
Entry
106567894         CDS       T04363                                 

Definition
(RefSeq) arrestin red cell isoform 3
  KO
K04439  beta-arrestin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106567894
   04340 Hedgehog signaling pathway
    106567894
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106567894
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106567894
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    106567894
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 106567894
NCBI-ProteinID: XP_013993234
UniProt: A0A1S3LRM6
LinkDB
Position
ssa13
AA seq 421 aa
MGDKAGTRVFKKSSPNCKVTVYLGKRDFVDHLNQVDPVDGVILVDPEYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPPIAEERKANSRLQERLLKKLGQQAHPFYFTV
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPG
PQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRLKISVRQYA
DICLFSTAQYKCPVAQVEAECVPLLSDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKL
KHEDTNLASSTIVKDVTNKEVLGILVSYRVKVKLVISRGGLLSGVLERDVSVELPFVLMH
PKPTELPISRPQSAVPDSDPPIDTNLIEFETNSFSQDDDFVFEDFARLRLKGMADDKDDD
C
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgggggataaggccggcaccagagtcttcaagaagtcaagccccaactgcaaggtcaca
gtatacctgggaaagagagactttgtggatcaccttaaccaggtggacccagtcgatggt
gtgatcctagtggaccctgagtatctgaaagacaggaaagtgtttgtgaccctgacgtgt
gcgttccgctatggccgtgaggacctggacgtgctgggcctgtctttccggaaagatctg
tacatctccaccttccaggccttcccccccatcgcagaggaacgcaaagccaacagccgc
ctgcaggagagactactgaagaaactgggccagcaggcacaccccttctacttcactgtt
ccccagaacctgccgtgctcagtcaccttacagccgggaccagaggacacagggaaggca
tgtggagttgactttgagatcagagcgttctgtgccaaatcgatagaggagaagattcac
aaacggaactctgtgcggctggtgatccgtaaggtgcagtatgccccagagaagcctggg
cctcagcccatggtggagaccacacggagcttcctcatgtcggaccgctcactacacctg
gaggcctctctggataaagagctctactaccatggagaacccatcagcgtgaacgttcat
gtcaccaacaactccacaaagactgtcaaaagactcaaaatctcagtgcgacagtatgct
gatatctgtctgttcagtacggctcagtacaagtgtccagtggctcaggtggaggcagag
tgtgttcctctcctcagtgaccaggtgtcgtctagctctacgttctgtaaggtgtacacc
ctcacacccacgctagacaagaaccgagagaagagaggccttgccctggacggaaagctc
aaacacgaggacaccaacctggcctccagcaccattgttaaggatgtgactaacaaggag
gttcttggaatcctggtgtcctacagggtcaaagtcaaactggtaatatctcgtggaggg
ctgctgagtggcgtgttagaaagagatgtgtcagtggagctgcccttcgtcttaatgcac
ccaaaacccacagaactgcccatatcccgcccacagtcagctgtgccggattcggaccct
cccatcgacaccaacctgatagaatttgaaacaaatagtttctcccaagacgacgacttt
gtgtttgaggacttcgcccgcctgcggctcaaaggaatggctgacgacaaggacgacgac
tgctag

KEGG   Salmo salar (Atlantic salmon): 106577890
Entry
106577890         CDS       T04363                                 

Definition
(RefSeq) arrestin red cell isoform 1-like
  KO
K04439  beta-arrestin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106577890
   04340 Hedgehog signaling pathway
    106577890
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106577890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106577890
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    106577890
SSDB
Motif
Pfam: Arrestin_C VPS28
Other DBs
NCBI-GeneID: 106577890
NCBI-ProteinID: XP_014011796
UniProt: A0A1S3N9L5
LinkDB
Position
ssa18
AA seq 273 aa
HYIISNPKCCSTETKQQTLSLSQYFWSSLYIDPQPLPFITHSCSLSFILSFSPLFLPLSF
SPSISLPLSQLYYHGEPISVNVHATNNSTKTVKRLKISVRQYADICLFSTAQYKCPVAQE
EADDQVSPSSTFCKVYTLTPTLTNNREKRGLALDGKLKHEDTNLASSTIVKDVSNKEVLG
ILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPSDLPMSRPQSVVPETDAPVGSNLIEFET
NNFSQDDDFVFEDFARLRLKGTKDDKDEDDHLC
NT seq 823 nt   +upstreamnt  +downstreamnt
ccattatatcatttcaaatccaaagtgctgcagtacagagacaaaacaacaaactttgtc
actgtcacaatatttttggagctcactgtatattgacccccaacccctcccctttatcac
tcattcttgttctctctctttcatcctctctttctcccctctctttctccccctctcttt
ctccccctctatttctctccctctctctcagctctactaccatggagaacctatcagtgt
gaatgtccatgcgaccaacaactccaccaaaacagtcaagaggttgaaaatctcagttcg
ccagtatgctgacatttgtctgttcagtacggctcagtacaagtgtcctgttgcacagga
agaggcagatgaccaggtgtcccccagcagtacgttctgtaaggtgtacaccctgactcc
cacgctcaccaacaaccgggaaaagagaggcctggcactggacggcaagctgaagcacga
agacaccaacctggcctccagcaccatagtgaaagatgtgtccaataaggaggttctggg
gatcctggtgtcctacagagtcaaggtcaagctagtggtgtctcgcggaggggatgtgtc
ggtggagctgccttttgttctgatgcaccccaaaccctctgacctacccatgtccagacc
tcagtcagtcgtcccagaaacagatgccccagttggcagtaacctgatagagtttgagac
aaataatttctctcaggatgatgactttgtgttcgaggactttgcccgtctgcggctgaa
aggaacgaaggacgataaggatgaggatgaccacttgtgctag

KEGG   Salmo salar (Atlantic salmon): 106603582
Entry
106603582         CDS       T04363                                 

Definition
(RefSeq) arrestin red cell isoform 2
  KO
K04439  beta-arrestin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106603582
   04340 Hedgehog signaling pathway
    106603582
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106603582
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106603582
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    106603582
SSDB
Motif
Pfam: Arrestin_N Arrestin_C CBM_3 VPS28
Other DBs
NCBI-GeneID: 106603582
NCBI-ProteinID: XP_014052917
UniProt: A0A1S3RM70
LinkDB
Position
ssa04
AA seq 405 aa
MGDKAGTRVFKKSSPNCKVTVYLGKRDFVDHLDQVDPVDGVILVDPEYLKERKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPPIAEECKANSRLQERLLKKLGQQAHPFYFTI
PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPG
PQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQYA
DICLFSTAQYKCSVAQVEADDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTN
LASSTIVKDVTNKEVLGILVSYRVKVKLVISRGGDVSVELPFVLMHPKPTELLISRPQSA
VPESDPPIDTNLIEFESNSFSQDDDFVFEDFARLRLKGMADDEDC
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgggggacaaggcgggcaccagagtcttcaagaaatcaagccccaactgcaaggtcaca
gtatacctgggaaagagagactttgtggatcaccttgaccaggtggacccagtcgatggt
gtgattctagtggaccccgagtatctgaaagaaaggaaagtgtttgtgactctgacgtgt
gcattccgctatggccgtgaggacctggacgtgctgggcctgtccttccggaaggatctg
tacatctccaccttccaggccttccctccaatcgcagaggaatgcaaagccaacagtcgc
ttgcaggaaagactactgaagaaactgggccagcaggcacaccccttctacttcacaatt
ccccagaacctgccgtgctcagtcaccttacagccaggaccagaagacacggggaaggcg
tgtggggtagactttgagatccgagcgttctgtgccaaatcgatagaggagaagattcac
aaacggaactctgtgcggctagtgatccgtaaggtgcagtatgccccagagaagcctggg
cctcagcccatggtggagaccacacggagcttcctcatgtcggaccgctcactacacctg
gaggcctctctggataaagagctctactaccatggagaacccatcagcgtgaatgttcac
gtcaccaacaactccaccaagactgtcaaaagagtcaaaatctcggtgcgacagtatgct
gatatctgtctgttcagtacggctcagtacaagtgttcagtggctcaggtggaggcagat
gaccaggtgtcgtctagctctacgttctgtaaggtgtacaccctcactcccacgctagac
aagaaccgtgagaagaggggcctggccctggacggaaagctcaaacatgaggacaccaac
ctggcctccagcaccattgttaaggatgtaactaacaaggaggtccttggaatcctggtc
tcctacagggtcaaagtaaaactggtcatctctcgtggaggagatgtgtcggtggagctg
ccctttgtcttaatgcaccccaaacccacagaactgctcatatcccgcccacagtcagct
gtgccggagtcagaccctccgatcgacaccaacctgatagaatttgaatcaaatagtttc
tcccaagatgacgactttgtgttcgaggacttcgcccgcctgcggctcaaaggaatggca
gacgacgaggactgttag

KEGG   Salmo salar (Atlantic salmon): 106608931
Entry
106608931         CDS       T04363                                 

Definition
(RefSeq) arrestin red cell isoform 1-like
  KO
K04439  beta-arrestin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106608931
   04340 Hedgehog signaling pathway
    106608931
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106608931
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106608931
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    106608931
SSDB
Motif
Pfam: Arrestin_N Arrestin_C
Other DBs
NCBI-GeneID: 106608931
NCBI-ProteinID: XP_014062647
UniProt: A0A1S3SE85
LinkDB
Position
ssa07
AA seq 410 aa
MGDKAGTRVFKKSSPNCKLTVYLGKRDFVDHLDHVDPVDGVLLIDPEYLKDRKVFVTLTC
AFRYGREDLDVLGLSFRKDLYISTFQAFPAVTTEEERKPLSHLQERLLKKLGQHAHPFNF
TIPQNLPCSVTLQPGPEDTGKACGVDFEVRAFCARTVEEKIHKRNSVRLVIRKVQYAPEK
PGPQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRVKISVRQ
YADICLFSTAQYKCPVAQEEADDQVSPSSTFCKVYTLTPMLTNNREKRGLALDGKLKHED
TNLASSTIVKDMSNKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPSDQHISRPQ
SAVPETDAPVDTNLIEFETNNFSQDDDFVFEDFARLRLKGMKDDEDDHFC
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgggagacaaggcaggcaccagagtcttcaagaagtccagtcccaactgcaagctcact
gtatacctgggaaagagagactttgtggatcacctagaccatgtagatccagtggatgga
gtgctactaatagacccagagtacctaaaagaccgaaaagtctttgtgactctgacctgt
gcgttccggtatggtcgtgaggacctggacgttctggggttgtcctttaggaaagacctc
tacatctccaccttccaggccttccccgccgtcaccacggaggaagagcgtaaaccactc
agccacctgcaggagagactgctgaagaagctgggccagcacgcacacccattcaacttc
actatccctcagaacctgccctgctcagtcactctacagccaggaccagaggacacaggg
aaggcttgtggagtggactttgaggtcagagccttctgcgccaggaccgtagaggagaaa
atacacaaaaggaactccgtgcgtctggtgatccgtaaggtgcagtatgcccctgagaag
cccggtcctcagcccatggtggagacaacgcgatccttcctaatgtcagatagatcccta
catctagaggcctcgctggataaagagctctactaccacggagagcctatcagtgtgaat
gtccatgtcaccaacaactccaccaaaacagtgaagagggtgaaaatttcagtgcgtcag
tatgctgatatctgtctgttcagtacggctcagtacaagtgtcctgttgcacaggaggag
gcagatgaccaggtgtcccccagcagtacgttctgtaaggtgtacaccctgactcccatg
ctcaccaacaacagagagaagagaggcctggctctggatgggaagctgaagcacgaagac
accaacctggcctccagcaccatagtgaaagacatgtccaataaggaggttctgggaatc
ctggtgtcttacagagtcaaggtcaaactagtggtgtcccgtggaggcgacgtgtcagtg
gagctaccttttgtcctgatgcaccccaaaccctcagaccaacacatttccagacctcaa
tcagccgtcccagaaactgatgccccagtggacactaaccttatagagtttgagacaaat
aatttctctcaggatgatgactttgtgttcgaggactttgcccgtctccgactgaaagga
atgaaggatgatgaggatgaccacttctgctaa

KEGG   Salmo salar (Atlantic salmon): 106613326
Entry
106613326         CDS       T04363                                 

Definition
(RefSeq) beta-arrestin-1
  KO
K04439  beta-arrestin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613326
   04340 Hedgehog signaling pathway
    106613326
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106613326
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106613326
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   GPCR adaptor proteins
    106613326
SSDB
Motif
Pfam: Arrestin_N Arrestin_C AP3B1_C
Other DBs
NCBI-GeneID: 106613326
NCBI-ProteinID: XP_014070901
UniProt: A0A1S3T2T1
LinkDB
Position
ssa09
AA seq 503 aa
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHVDLVEPVDGVVLIDPEYLKERKVFVTLTCA
FRYGREDLDVLGLTFRKDLFVANIQAFPPVPEDKKRLTRLQERLIKKLGEHAHPFTFEIP
LNLPCSVTLQPGPEDTGKACGVDFEVKAFCSENVQDKIHKRNSVRLVIRKVQYAPEKPGP
QPMAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKMKISVRQYAD
ICLFNTAQYRCPVATEETDDVVAPSSTFCKVYTLTPFLNNNREKRGLALDGKLKHEDTNL
ASSTLLREGANKEILGIIVSYKVKVKLVVSRGGLLGDLATSFIFFSSDVHVELPFTLMHP
KPIEDAIYRDAADEAPIDTNLIEFDTNPSLAMQPNSPSLAVQPNSPSLAVQPNSPSLAVQ
PNSPSLAMQPNSPSLAVQPNSPSLAMQPNSPSLAMQPNSPSLAVQPNSPSLAMQPNSPSL
AVHINQHICPIMNNTFNIQCLSM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggagataaaggcacaagggtattcaaaaaagcaagtcccaatggaaagctcacagtg
tacctggggaagagggactttgtggaccatgttgacctggtggaacccgtagacggtgtg
gtgttgatagatccggagtacctgaaagagagaaaagtgtttgtgacgttgacatgcgcc
ttccgttatggacgtgaggacttggatgttctgggcttgacgtttcgaaaggacctcttc
gtggccaacatccaggccttccctccagtgccagaagacaaaaagaggttaactcgcctt
caagaacgcctgatcaaaaagcttggggaacatgctcaccctttcacctttgagattcca
ctgaatttaccgtgctcagtcaccctgcagcccggaccggaggacacagggaaggcctgc
ggggttgactttgaagtcaaagctttctgctcagaaaacgtccaagacaaaatacataaa
aggaactcagtgcgtctggtgatccgtaaggtccagtacgccccagagaagcccggcccc
cagcccatggctgagaccaccagacagttcctgatgtctgacaagccactgcaccttgag
gcctcactggataaagagatctactaccacggggagcctatcagtgtcaacgttcacgtc
acaaacaacaccaacaagacagtgaagaaaatgaagatttcagtgcgtcagtatgcagac
atctgcctattcaacacagcacaatacagatgcccggtcgctacagaggagacagatgac
gtggtggctccaagttcaacgttttgtaaagtctacaccctcacccccttcctcaacaac
aaccgggagaagcgtggtctggcattggacgggaaactgaaacacgaggacacaaacctg
gcttctagtacattgttaagagagggagccaacaaggagatcctgggtatcatcgtatcc
tacaaagtcaaagtgaagcttgttgtgtctcgaggcggactcttaggagatcttgcaaca
agtttcattttcttttccagcgacgtccatgttgagctcccctttacgttaatgcatccc
aaaccaatcgaagatgcaatctacagagatgctgcggacgaggcgccaatagacacaaac
ttgatagaatttgacacaaacccatctctggccatgcagcctaacagcccatctctggcc
gtgcagcctaacagcccatctctggccgtgcagcctaacagcccatctctggccgtgcag
cctaacagcccatctctggccatgcagcctaacagcccatctctggccgtgcagcctaac
agcccatctctggccatgcagcctaacagcccatctctggccatgcagcctaacagccca
tctctggccgtgcagcctaacagcccatcgctggccatgcagcctaacagcccatctctg
gccgtgcacattaaccagcatatatgcccaattatgaataatacattcaatattcaatgt
ctttcaatgtaa

DBGET integrated database retrieval system