KEGG   Salmo salar (Atlantic salmon): 106567936
Entry
106567936         CDS       T04363                                 

Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106567936
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 106567936
NCBI-ProteinID: XP_013993325
UniProt: A0A1S3LR76
LinkDB
Position
ssa13
AA seq 347 aa
MTDSVRAFLRNVATGIKDSILGIGTISKLDARIQQKREEQRKRRASGALAQRRAQSEERK
QESHTLSFSEPKLASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQTLTARIIGDPSLHGNV
WSWLEFILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGRKAQPFPSVSKIIADM
LFNLLLQALFLIQGMVVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNHGIEMHQRLSN
IERNWPYYFGFGLPMALLTALPSSYIISGCLFSILFPLFIISANEAKTPTKLYHFQLRLF
SLVVLISNKLFHKTVHLQSSLTLSTSTEKLPPSPHASPGRQRPLPSQ
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgacagacagtgtcagggccttcctccgtaatgttgcgacggggattaaggactccatt
ttggggatcggaactatctccaagctggatgcccgcatccagcagaaaagggaggagcag
cgaaagaggagagccagcggggccctggctcagagacgggcccagagtgaggaacgcaaa
caggagagtcatactctctctttcagtgaacccaaattagccagtaggatttttcagtgc
tgtgcgtggaatgggggagtgttctggctcagtctgttcctcttctatcgggtgtttatt
ccactgctgcagactctgacagcaagaattatcggtgacccctcactccatggtaacgtg
tggtcctggctggagttcatattgacctccgtgttcagtgctctctgggtgctccctctg
tttgtgctcagcaagatagtcaacgccatttggttccaggacatagctgacctggcgttt
gaggtgtctggtcggaaagcccagcccttccccagcgtcagtaagattatcgctgacatg
ctcttcaacctcctcctccaggccctcttcctcattcagggtatggttgtgagtctcttc
cccatcgatgccattggacagatggtcagccttcttcacatgtctttgctctactccctc
tactgctttgagtatcgctggttcaaccatggcattgagatgcaccaacggctgtccaac
attgagaggaactggccctactactttggctttggtctccccatggctctattgactgcc
ctcccctcttcatatattataagtggctgtctgttctccatcctcttccctctgttcatc
atcagcgctaacgaggccaagaccccaacaaagttatatcacttccagctgcgcctcttc
tctctggttgtgctgattagcaacaagttgttccacaaaacggtccacctacagtcgtcc
ttgactttgtccacttccaccgagaagctgcccccctctccccacgcctcacctggccgc
cagagacccctaccctcccagtga

KEGG   Salmo salar (Atlantic salmon): 106603545
Entry
106603545         CDS       T04363                                 

Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106603545
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 106603545
NCBI-ProteinID: XP_014052857
UniProt: A0A1S3RM25
LinkDB
Position
ssa04
AA seq 341 aa
MTDSIRAFLRNVATGTKDSILGIGTISKLDARIQQKREEQRRRRASGALAQRRAQSEERK
QESEPKLASRIFQCCAWNGGVFWLSLFLFYRVFIPLLQTLTAIIIGDPSLHGNVWSWLEF
ILTSVFSALWVLPLFVLSKIVNAIWFQDIADLAFEVSGRKAQPFPSVSKIIADMIFNLLL
QALFLIQGMVVSLFPIDAIGQMVSLLHMSLLYSLYCFEYRWFNHGIEMHQRLSNIERNWP
YYFGFGLPMALLTALPSSYIISGCLFSILFPLFIISANEAKTPTKLYHFQLRLFSLVVLI
SNKLFHKTVHLQSSLNSSISAEKLPTSPHASPARQRPLPSQ
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgacagacagcatcagggccttcctccgcaatgttgcgacggggactaaggactccatt
ttggggatcggaactatctccaagctggatgcccgcatccagcagaaaagggaggagcag
cggaggaggagagccagcggggccctggctcagagacgggcccagagtgaggaacgcaaa
caggagagtgaacccaaattagccagtaggatttttcagtgctgtgcctggaatggggga
gtgttctggctcagtctgttcctcttttaccgggtgtttattccactgctgcagactctg
acagcaataatcatcggtgacccctctctccatggcaacgtgtggtcctggctggagttc
atattgacctctgtgttcagtgctctctgggtgctccctctgtttgtgctcagcaagata
gtcaacgccatctggttccaggacatagctgacctggcgttcgaggtctctggtcggaaa
gcccagcccttccccagcgtcagtaagatcatcgctgacatgatcttcaacctcctcctc
caggctctcttcctcattcagggtatggttgtgagtctcttccccatcgacgctattgga
cagatggtcagccttctccacatgtctctgctctactccctctactgctttgagtatcgc
tggttcaaccatggcattgagatgcaccaacggctgtccaacattgagaggaactggccc
tactactttggctttggtctccccatggctctgttgactgccctcccctcttcatatata
atcagtggctgtctgttctccatcctcttccctctgttcattatcagcgctaacgaggcc
aaaaccccaacaaagctataccacttccagctgcgcctcttctctctggttgtgctgatt
agcaacaagttgttccacaagacggtccacctgcagtcctccctgaactcgtccatctcc
gccgagaagctgcctacctctccccacgcctctcctgcccgccagagacccctgccctcc
cagtga

KEGG   Salmo salar (Atlantic salmon): 106611351
Entry
106611351         CDS       T04363                                 

Gene name
tp53i3
Definition
(RefSeq) tumor protein p53 inducible protein 3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106611351 (tp53i3)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     106611351 (tp53i3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N DUF325
Other DBs
NCBI-GeneID: 106611351
NCBI-ProteinID: XP_014066972
UniProt: A0A1S3SRK4
LinkDB
Position
ssa09
AA seq 372 aa
MATLLHYLNQHCVNFAPVGLSSTHLLYQRAADVLFMMTAVCVDTPGGPESMLLRNVPRPQ
PEHGEVLIRVHATALNRADTLQRKGLYPAPPGESEVLGLEAAGTVASVGPGVRLSWGLGD
WVMTLLSGGGYAEYVAVPEELLMSIPTHLTVYQAAAIPEAWLTAFQLLHFVAQVKEGEIV
LVHAGASGVGTAAVQLVRLAGAIPIVTAGSSEKLQMAETLGAAAGFNYKHEDFAEKVSDF
TAGRGANVILDCIGGSNWERNVACLATDGRWVLYGCMGGKTVTGDILGKLLSKRGQLLCS
LLRSRSLQYKADLVRAFSERALPHFSDPTSSPCRLRPVIDSMFSLDQVADAHRHMEANRN
MGKIVINVMNPQ
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctacattgttgcactacctcaatcaacactgcgtaaactttgcgccagtaggcctg
tcatcaacgcatttattgtatcaacgggctgcagatgttttgtttatgatgacggcagtg
tgtgtggacacaccagggggaccagagagtatgctgttgaggaatgtccccagacctcaa
cctgaacatggagaagtcctcatcagagtccatgcaaccgctctgaacagggctgacaca
ttgcagaggaaaggactgtaccccgctccacctggtgagagtgaggtcctgggtttggag
gcggctggtacagtggccagcgttggcccaggggttaggctgtcctgggggctaggggac
tgggtcatgaccctactctctggaggagggtatgccgagtatgtggctgttccagaggag
cttctcatgtctatccccactcatctcactgtctaccaggctgctgccatacctgaggcc
tggctcactgcatttcagctcctgcacttcgtagctcaggtgaaggaaggagagatagtg
ttggtgcatgctggggccagtggggtggggactgccgctgtccagctggtccgattggct
ggggctattcccatagttactgcaggaagctctgagaaactacagatggcagagacactg
ggagccgctgctggtttcaactacaaacatgaggactttgcagagaaagttagtgatttt
acagcaggcagaggagcaaacgtcatcttggactgcattggtgggtccaactgggagagg
aacgtggcctgtctggccacagatggacgatgggtgctgtatggctgcatgggaggaaag
accgtgacaggagacatactgggcaagctgctgtctaaacgaggacagctcctctgtagt
ctcctcaggtcacgcagtctgcagtataaagcagatctggtgagagccttctcagaaagg
gccctacctcacttctcagacccgactagctccccctgccgcctgaggcctgtaatcgac
agcatgttcagtctggaccaggtagctgatgctcacagacacatggaagccaatagaaac
atgggaaagattgtaatcaatgtcatgaacccacaatga

DBGET integrated database retrieval system