KEGG   Salmo salar (Atlantic salmon): 106567964
Entry
106567964         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106567964
   04350 TGF-beta signaling pathway
    106567964
   04371 Apelin signaling pathway
    106567964
   04150 mTOR signaling pathway
    106567964
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106567964
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106567964
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106567964
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106567964
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106567964
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Seadorna_VP7 DUF1015
Other DBs
NCBI-GeneID: 106567964
NCBI-ProteinID: XP_013993363
UniProt: A0A1S3LQV4
LinkDB
Position
ssa13
AA seq 511 aa
MAGVFDIDLDQADENVSDDELGDGTQMSECTEQCSGFEFNMDDCEKFEISEDSVNKGTEQ
IRPECFELLRVLGKGGYGKVFQVRKVSGATSGKIFAMKVLKKAMIVRNAKDTAHTKAERN
ILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGILVEDKACFYLAEISMA
LGHLHQKGIIYRDLKPENIMLNNNGHIKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEIL
MRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLK
KLLKRNASLRLGAGPGDASEIQSHQFFRHIKWDELLARKVEPPFKPVLQSADDVSQFDSK
FTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENVKEKFPFEQKVRSPRRFLGSPRTP
VSPVKFAGGDCWPRAPTQARVSSLLFPGGSGSGDQPMEVGVEQMDVSSKATEVSAPLPIK
KPSGNTTTGGPFKKQAYPLMSKHPEHLRMNL
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggcgggggtattcgacattgatttggatcaggcggacgaaaatgtgtctgatgacgaa
ctcggggatgggacccaaatgagcgaatgcacggagcaatgcagcgggttcgaatttaac
atggacgactgtgaaaagtttgaaatctctgaagacagcgtcaacaaaggaacggagcag
attcgtccggaatgctttgagttactccgggttttaggaaaaggaggctatggaaaggtt
tttcaagttcgtaaggtgtcgggtgccacttcgggaaagattttcgccatgaaggtcttg
aagaaggcgatgatagtgcgtaacgctaaggacacggcacacaccaaggcagagaggaac
atcctggaggaggtgaagcacccattcatagtggacctcatctatgccttccagacaggg
ggcaagctgtacctcatcctggagtacctcagtggtggggagctgtttatgcaattggag
agagaggggatccttgtggaggacaaagcatgcttctatctggcagagatttcaatggct
ctgggacacctgcatcagaaaggcatcatctacagagacctgaagccagaaaacatcatg
ctcaacaacaacggtcacatcaagctcacagactttggactgtgtaaagaatcaatccac
gatggcacggttactcacactttctgtggcaccatagaatacatggccccagagatcctg
atgaggagtggacacaaccgggctgtagactggtggagcctgggagctcttatgtatgac
atgctgacaggagcaccaccattcactggtgaaaacaggaagaagaccattgacaaaatc
ttaaagtgtaaattgaacttgccaccttacctcacacaagaagccagggaccttctcaaa
aagctgctaaaacgcaacgcctcgttacggctgggggcgggcccaggagacgcctcagaa
attcagtcccaccaattcttcaggcatattaaatgggacgaacttctcgctcgcaaagtg
gagcctccattcaagcctgttctgcaatcagctgatgacgtgagccagtttgactccaag
ttcaccagccagactcctgttgacagccctgacgactccacgctcagtgaaagtgccaat
caagttttcctgggctttacgtatgtagccccctctgtgcttgaaaacgtcaaggagaaa
ttcccctttgagcaaaaagtccgctcaccaagaaggtttctgggaagcccaagaacacca
gtgagcccagtgaagtttgctgggggggattgctggccccgggcccccacccaggctaga
gtctcgtccctgctgttccctgggggctctgggtctggagaccagcccatggaggttggt
gtggagcagatggacgtgagctccaaagctactgaggtgtctgcccccctgcccatcaaa
aagccctctggcaacaccaccacaggcggccccttcaagaagcaggcctaccccctgatg
tccaaacatcccgagcacctccggatgaatctatga

KEGG   Salmo salar (Atlantic salmon): 106581130
Entry
106581130         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106581130
   04350 TGF-beta signaling pathway
    106581130
   04371 Apelin signaling pathway
    106581130
   04150 mTOR signaling pathway
    106581130
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106581130
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106581130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106581130
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106581130
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106581130
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 106581130
NCBI-ProteinID: XP_014018426
UniProt: A0A1S3NT85
LinkDB
Position
ssa20
AA seq 505 aa
MAGIFDIDLDQPEENVSDDELEETQINDFMDQCSGFEFNMDDCEKIEISEDNVNQGTENI
RPECFELLRVLGKGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAKDTAHTKAERNI
LEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMAL
GHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHGGTVTHTFCGTIEYMAPEILM
RSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKR
LLKRNASSRLGAGAGDATEVQAHPFFRHINWEELLARKVEPPFKPFLQSAEDVSQFDSKF
TSQTPVDSPDDSTLSESANQAFLGFTYVAPSVLENVKEKFSFEPKIRSPRRFLGSPRTPV
SPFKFSAGDVWPRGPLMPGGSALCLQSPQEQVMEVSAPEQMEVQTSSEASAPLPIRQPSG
ANLSQFKQQAYPVMAKRPEHLRINL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcgggtatattcgacatcgatttggatcagccggaggaaaatgtctccgacgatgag
ctcgaggagactcagatcaacgatttcatggaccagtgcagcggctttgagttcaatatg
gacgactgtgagaagatcgagatatctgaggacaacgtcaatcaaggaacagagaacatc
aggccagagtgttttgagctgctgcgagtgctgggaaagggcggttatggaaaggttttt
caagttcgaaaagttgctggggcagcatcggggaaaatatttgcaatgaaggttttaaag
aaggctatgattgtacgcaatgctaaggacactgcccacaccaaggcggagaggaacatc
ctggaggaagtgaagcatcctttcatcgtggatctcatctacgccttccagacgggggga
aagctgtacctcatcctggagtacctcagcggtggagagctgtttatgcaactggaaaga
gaggggatttttatggaagacacagcctgtttttacctggcagaaatctccatggctctg
ggccatctgcaccagaaaggcatcatctatagagacctgaagcctgaaaacatcatgctt
aacaaccaaggccatgtgaaattgactgactttgggctgtgtaaagagtccatccacggc
ggcacagtcacccatactttctgtggcaccatagagtacatggccccagagatcctgatg
agaagtggacataacagagcagtggactggtggagtcttggagcgcttatgtatgatatg
ctgactggagcgccacccttcactggtgaaaacaggaagaagaccattgacaaaatctta
aaatgcaagctgaacctcccaccctacctcacacaagaagccagagatctcctgaaaagg
ctgctgaagagaaatgcctcgtcaagacttggagcaggggccggagatgctacagaggtg
caggctcatcccttcttccgacacattaactgggaagagctcctggccaggaaagtggag
cctccattcaagcctttcctgcaatccgctgaagatgtgagccagtttgactctaagttc
accagccagacaccagtagacagcccagacgattccacgctgagtgaaagcgctaaccaa
gcctttctgggctttacgtatgttgctccatcagtacttgaaaacgtcaaggaaaaattc
tcattcgagccaaaaatccgctcaccccgacggtttttggggagcccaagaacaccagtc
agccctttcaagttctctgctggtgacgtgtggccccggggccccttgatgcccggcgga
tccgctctatgtctccagtcgccccaggagcaggtcatggaggtgtccgccccagaacag
atggaagtgcagaccagctctgaggcctctgcgccccttcccattcgccagccttcggga
gccaacctgtcccagttcaaacaacaggcctaccctgtcatggccaagcggcccgagcat
ctacgcattaacctatga

KEGG   Salmo salar (Atlantic salmon): 106602694
Entry
106602694         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-2-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106602694
   04350 TGF-beta signaling pathway
    106602694
   04371 Apelin signaling pathway
    106602694
   04150 mTOR signaling pathway
    106602694
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106602694
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106602694
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106602694
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106602694
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106602694
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106602694
NCBI-ProteinID: XP_014050955
UniProt: A0A1S3RF71
LinkDB
Position
ssa04
AA seq 519 aa
MCVPEQLKKPSPKTSQNLVVIYAQTLPKCFCCEACGPLLWSEIPAKRMAGVFDIDLESED
LSDAEDDVCDFTLAETDPVQTEEIELTSAIVNRDSERIGPDSFELLSVLGKGGYGKVFQV
RKVQGAQTGKIFAMKVLKKAKIVCNAKDTAHTRAEREILETVRHPFIVDLLYAFQTGGKL
YLILECLSGGELFMQLEKEGIFMEDTACFYLGEIVLALGHLHSNGIIYRDLKPENIMLNH
QGHIKLTDFGLCKESIHDGAVTHTFCGTIEYMAPEILTRTGHNRAVDWWSLGALMYDMMT
GSPPFTAENRKKTIDKILKCKLHLPPYLTLDARDMIKKLLKKSPLQRLGSSAADCKDIQK
HPFFRHINWDDLLNKRCEPPYKPCLQSDEDVSQFDTRFTKQTPVDSPDDSTISHQHEHAF
AGFTYVAPSVLESLKEGFSFEPRTRPVRRHNSSPRTPISPLKFSLPGSFAKSTGGGESES
DLLSQTSFHLPPTAPPTDNGATQPIRTPGRNKKQKGNRR
NT seq 1560 nt   +upstreamnt  +downstreamnt
atgtgtgtgcctgaacagctgaaaaaaccctcaccaaaaacatcacaaaatcttgtcgta
atatatgcacaaactcttccgaaatgtttctgctgtgaagcatgtggaccgcttttgtgg
agcgagatacctgccaaaaggatggctggtgttttcgatattgacctggagtcagaagac
cttagcgatgccgaggatgacgtttgtgacttcacattagcagagacagaccctgttcaa
acagaagagatagagctgaccagtgccattgtcaacagagacagtgagaggatcggacca
gacagctttgagctgctaagtgtgctgggcaaggggggctatggcaaggttttccaggta
cggaaagtgcagggtgcacagacagggaagatattcgccatgaaggttttaaagaaggcg
aagattgtgtgtaacgcaaaggacacagcccacacgcgtgcagagcgggagattctggag
acggtgcggcaccccttcatcgtggacctgctgtatgccttccagactgggggtaaactc
tacctcatcctggaatgtctcagtggtggagaactgttcatgcagctggagaaagaagga
atcttcatggaggacacagcctgtttttatctgggcgagattgtgcttgctttgggacac
ctccactcaaatggaatcatctaccgagatctcaaaccagagaatatcatgctgaaccac
caaggacacatcaagctgactgactttggcctgtgtaaggagtctattcacgacggagcg
gtcacgcacaccttctgtgggaccatagagtacatggctccagagattctgacacgtaca
ggacacaaccgggcggtggactggtggagtcttggagccctgatgtatgacatgatgacg
ggctcgcctccgttcactgctgagaacaggaagaagaccattgataagatcttgaagtgt
aaactccacctaccgccctatctcacactggacgcccgagatatgatcaaaaagctgctg
aagaagagtcctcttcagcgactaggctctagtgcggcagactgtaaagacatacagaag
catcccttcttcagacacatcaactgggacgacctgctgaataagaggtgtgagccgccc
tacaagccatgcctgcagtcggatgaggacgtgagccagtttgacacgaggttcaccaag
cagaccccagtggacagtcccgacgactccacaatcagccaccagcacgaacacgccttc
gctggttttacctatgtggctccctctgtgttggagagtctgaaggagggattctccttt
gagccacggacacgtcctgtacgcagacacaacagcagtccacgcacccccatcagtcct
ctcaagttctctctccccgggtcatttgccaagtccacagggggaggagagagcgagtcg
gaccttctctcccagacctcgttccatctcccgccaaccgccccgcccaccgacaacggc
gccacgcaaccaatccgcacgccgggccggaacaagaagcagaagggtaaccggagatga

KEGG   Salmo salar (Atlantic salmon): 106603521
Entry
106603521         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106603521
   04350 TGF-beta signaling pathway
    106603521
   04371 Apelin signaling pathway
    106603521
   04150 mTOR signaling pathway
    106603521
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106603521
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106603521
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106603521
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106603521
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106603521
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106603521
NCBI-ProteinID: XP_014052799
UniProt: A0A1S3RM52
LinkDB
Position
ssa04
AA seq 529 aa
MLLHEAVKESLSFALSEREQAKAMAGVFDIDLDQQDENVSEDELEDGIQMSEYGRQCSGF
EFNMDDCEKFEISEDSVNKGMEQIRPECFELLRVLGKGGYGKVFQVRKMSGATSGKIFAM
KVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFM
QLEREGIFMEDTACFYLAEISMALGHLHLKGIIYRDLKPENIMLSNNGHVKLTDFGLCKE
SIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTI
DKILKCKLNLPPYLTQEARDLLKKLLKRNASLRLGAGPGDSSEIQSHLFFRHINWDDLLA
RKVEPPFKPFLQSADDVSQFDSKFTSQTPVDSPDDSTLSESANQVFLGFTYVAPSVLENI
KEKFPFEPKVSSPRFLGNPRTPVSPVKFAVGDCWPRALTQAGTSSLGGFGSGDQPMEVGV
EQRAISSNEVSAPLPIRKPSGNTTTGGPFKKQAYPYPISKRPKHLQMNL
NT seq 1590 nt   +upstreamnt  +downstreamnt
atgttgctccatgaggcagtgaaggagagcctttcattcgcactgagtgagagggaacaa
gcaaaggccatggcgggggtattcgacattgatttggatcagcaggacgaaaatgtgtct
gaggacgaactcgaggatggaatccaaatgagcgagtatgggcggcaatgcagcgggttt
gaatttaacatggatgactgtgaaaagtttgaaatctctgaagacagcgtcaacaaagga
atggagcagattcgtccggaatgctttgagttgctccgagttttaggaaaaggaggctat
ggaaaagtttttcaagttcgtaagatgtcgggtgccacttcgggaaagatcttcgctatg
aaggtcttgaagaaggccatgatagtgcgtaacgctaaggacacagctcacaccaaggca
gagaggaacatcctggaggaggtgaagcacccgttcatagtggacctcatctatgccttc
cagacagggggcaagctgtacctcatcctggagtacctttctggcggggagctgtttatg
caattggaaagagaggggatctttatggaggacacagcgtgcttctatctggcagagatt
tccatggctttgggacacctgcatctgaaaggcatcatctacagagacctgaagccagag
aacatcatgctcagcaacaacggtcacgtcaagctcacagactttggcctgtgtaaagaa
tcaatccatgacggcactgttactcacaccttctgtggcaccatagaatacatggcccca
gagatcctgatgaggagtggacacaaccgggctgtagactggtggagcctgggagctctc
atgtatgacatgctgacaggagcaccaccattcactggggaaaacaggaagaagaccatt
gacaaaatcttaaagtgcaaactgaacctgccaccttacctcacacaagaagctagggat
cttctgaaaaagctgctgaaacgcaatgcctcgttacggctgggggcaggcccaggagac
tcctcagaaatccagagccacctgttcttcaggcatattaattgggatgatcttctcgct
cgcaaagtggagcctccattcaagccttttctgcaatcagctgatgatgtgagccagttt
gactccaagttcactagccagactcccgtggacagccctgatgactccacgctcagcgaa
agtgccaatcaagtcttcctgggttttacgtatgtagccccctccgtcctcgaaaacatc
aaggagaaattcccctttgagccaaaagtcagctcaccaaggtttctgggaaacccaaga
acaccagtgagcccagtgaagtttgctgtgggggactgctggccccgggccctcacccag
gctggaacctcgtcccttgggggttttgggtctggagaccagcccatggaggttggtgtg
gagcagagggccatttcctccaacgaggtgtctgcccccctgcctatcagaaagccctct
ggcaacaccaccacaggcggccccttcaagaagcaggcctacccctaccccatctccaaa
cggcccaagcacctccagatgaatctatga

KEGG   Salmo salar (Atlantic salmon): 106609967
Entry
106609967         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-2-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106609967
   04350 TGF-beta signaling pathway
    106609967
   04371 Apelin signaling pathway
    106609967
   04150 mTOR signaling pathway
    106609967
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106609967
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106609967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106609967
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106609967
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106609967
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106609967
NCBI-ProteinID: XP_014064516
UniProt: A0A1S3SJJ6
LinkDB
Position
ssa08
AA seq 475 aa
MAGVFDIDLESDDLSDAEDDICDFTVAETDLVQTEEIELTSAIVNRDSERIGPDSFELLS
VLGKGGYGKVFQVRKVQGTQTGKIFAMKVLKKAKIVCNAKDTAHTRAEREILETVRHPFI
VDLLYAFQTGGKLYLILECLSGGELFMQLEKEGIFMEDTACFYLGEIVLALGHLHSNGII
YRDLKPENIMLNHQGHIKLTDFGLCKESIHDGAVTHTFCGTIEYMAPEILTRTGHNRAVD
WWSLGALMYDMMTGSPPFTAENRKKTIDKILKCKVNLPPYLTLDARDMIKKLLKKSPSQR
LGSSAADCKDIQKHPFFRHINWDDLLNKRCEPPYKPCLQSDEDVSQFDTRFTKQTPVDSP
DDSTISHQHEHAFAGFTYVAPSVLESLKEGFSFEPRTRPVRRHNSSPRTPISPLKFSLPG
SFAKSTGGSGGGESESDLLSQTSFRLPPTTPPTDNGATQPISTPGRNKKQKGNRR
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggcaggtgttttcgatattgacctggagtcggacgaccttagcgatgcagaggatgac
atttgtgacttcaccgtagcagagacagaccttgttcagacagaagagatagagctgacc
agtgccattgtcaacagagacagtgagaggattggaccagacagctttgagctgctaagt
gtgctgggcaaggggggctatggcaaggttttccaggtacggaaagtgcagggtacacag
acggggaagatattcgccatgaaggttttaaagaaggcgaagatagtgtgtaacgccaag
gacacagcccacacgcgtgcagagcgggagattctagagacggtgcggcaccccttcatt
gtggacctgctgtacgccttccagaccgggggtaaactctacctcatcctggagtgtctc
agtggtggagaactgttcatgcagctggagaaagaaggaatcttcatggaggacactgcc
tgtttttatctgggtgagattgtgcttgctttgggacacctccactcaaacggaatcatc
taccgagacctgaaaccagagaatatcatgctgaaccaccaaggacacatcaagctgact
gactttggcctgtgtaaggagtccattcatgacggcgctgtcacgcacaccttctgtggg
accatagagtacatggctccagagattctgacccgtacaggacacaaccgggcggtggat
tggtggagtcttggagccctaatgtatgacatgatgacgggctcgcctccgttcactgct
gagaacaggaaaaagaccattgataagatcttgaagtgtaaagtcaacctaccgccctac
ctcacactggacgcccgagatatgatcaaaaagctgctgaagaagagtccttctcagagg
ctaggctccagtgcggcagactgtaaagacatacagaagcatcccttcttcagacacatc
aactgggacgacctgctgaataagaggtgtgagccgccctacaagccatgcctgcagtcg
gatgaggacgtgagtcagtttgacacgaggttcaccaagcagactccggtggacagtccc
gacgactccacaatcagccaccagcacgaacacgccttcgctggttttacctatgtggct
ccctctgtgttggagagtttgaaggagggcttctcctttgagccacggacacgtcctgta
cgcagacacaacagcagcccacgcacccccatcagtcctctcaagttctctctccccggg
tcattcgccaagtccacaggaggatcagggggaggagagagcgagtcggaccttctctcc
cagacctcgttccgtctcccgccaacaaccccgcccaccgacaacggtgccacgcagcca
atcagcacaccaggccggaacaagaagcagaagggtaaccggagatga

KEGG   Salmo salar (Atlantic salmon): 106613000
Entry
106613000         CDS       T04363                                 

Definition
(RefSeq) ribosomal protein S6 kinase beta-1-like
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04350  TGF-beta signaling pathway
sasa04371  Apelin signaling pathway
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613000
   04350 TGF-beta signaling pathway
    106613000
   04371 Apelin signaling pathway
    106613000
   04150 mTOR signaling pathway
    106613000
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613000
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106613000
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106613000
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   106613000
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 106613000
NCBI-ProteinID: XP_014070269
UniProt: A0A1S3T104
LinkDB
Position
ssa09
AA seq 505 aa
MAGVFDIDLDQPEENVSDDELEEAQINDFMDQCSGFEFNMDDCEKIEISEDNVNQGKENI
RPECFELLRVLGKGGYGKVFQVRKVAGAASGKIFAMKVLKKAMIVRNAKDTAHTKAERNI
LEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMAL
GHLHQKGIIYRDLKPENIMLNNQGHVKLTDFGLCKESIHGGTVTHTFCGTIEYMAPEILM
RSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKR
LLKRNASSRLGAGAGDATEVQAHPFFRHINWEELLARKVEAPFKPFLQSAEDVSQFDSKF
TSQTPVDSPDDSTLSESANQAFLGFTYVAPSVLENVKEKFSFEPKIRSPRRFLGSPRTPV
SPLKFSAGDVWPRGPLMPGGSSLCLQSPQEQVMYVSTPEQMDVQASSEASAPLPIRQPTG
ANLSQFKQQAYPVMAKRPEHLRMNL
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggcgggtgtattcgacatcgatttggatcagccggaggaaaatgtctccgacgatgag
ctcgaggaggctcagatcaacgatttcatggaccagtgcagcggctttgaattcaatatg
gacgactgtgagaagattgagatatctgaggacaacgtcaaccaaggaaaagagaacatc
aggccggagtgttttgagctgctgcgggtgctgggaaagggcggttatggaaaggttttt
caagttcgaaaagttgctggagcagcatcggggaagatatttgccatgaaggttttaaag
aaggctatgattgtacgcaatgctaaggacacggcccacaccaaggcagagaggaacatc
ctggaggaagtgaagcatcctttcatcgtggatctcatctacgccttccagacaggggga
aagctgtaccttatcctggagtacctcagcggtggagagctgtttatgcaactggaaaga
gaggggatttttatggaagacacagcctgcttttacctggcagaaatttccatggctctg
ggtcatctgcaccagaaaggcatcatctatagagacctgaagcctgaaaacatcatgctt
aacaaccaaggccatgtgaaactgactgactttggactgtgtaaagagtccattcacggc
ggcacagtcacccatactttctgtggcaccatagagtacatggctccagagatcctgatg
agaagtggacacaacagagcagtggactggtggagtcttggagcgcttatgtacgacatg
ctgactggagcgccacccttcactggtgaaaacaggaagaagaccattgacaaaatctta
aaatgcaagctgaacctcccaccctacctcacacaagaagccagagatctcctgaaaagg
cttctgaagagaaatgcctcgtcaagacttggagcaggggctggagatgctacagaggtg
caggctcatcccttcttccgacacattaactgggaagagctcctggccaggaaagtggag
gctccattcaaacctttcctgcaatctgctgaagatgtgagccagtttgactccaagttc
accagccagacaccagtagacagcccagacgactctacacttagtgaaagcgccaaccaa
gcctttctgggctttacgtatgttgctccatcagtactggaaaatgtaaaggaaaagttc
tcattcgagccaaaaatccgctcaccccgacggtttttggggagcccaagaacaccagtc
agccctctcaagttctctgccggtgacgtgtggccccggggcccattgatgcccggcgga
tcctctctatgtctccagtcgccacaggagcaggtcatgtatgtgtcaaccccagaacag
atggatgtgcaggccagctctgaggcctcagcccccctgcccatccgccagcctacgggg
gccaacctgtcccagttcaaacaacaggcctaccccgtcatggccaagaggcccgagcat
ttacgcatgaacctatga

DBGET integrated database retrieval system