KEGG   Salmo salar (Atlantic salmon): 106568099
Entry
106568099         CDS       T04363                                 

Gene name
FBW1B
Definition
(RefSeq) F-box/WD repeat-containing protein 11-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106568099 (FBW1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106568099 (FBW1B)
   04340 Hedgehog signaling pathway
    106568099 (FBW1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106568099 (FBW1B)
   04218 Cellular senescence
    106568099 (FBW1B)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106568099 (FBW1B)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     106568099 (FBW1B)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 106568099
NCBI-ProteinID: XP_013993605
UniProt: C0H9Q8
LinkDB
Position
ssa13
AA seq 525 aa
MEPEMEDKTLEQMNSTFMDSQTDERSKKTTVFKTITNGPMTGSRKRPSEGNYEKEKEVCI
QLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILS
FLDARSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTT
EVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGL
RDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTLI
HHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIV
SASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLR
VLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFR
LQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaacgttggagcagatgaactccactttcatggactcc
cagacagatgaacgatcaaagaaaaccacagtgttcaagacgatcacgaacggtccgatg
acaggctcaaggaagcgaccatcggaagggaactatgagaaggagaaggaagtgtgcatc
cagctgtttgaccagtggtctgaggctgaccaggtggagtttgtagaacacctgatctca
cgcatgtgccactaccaacacggccacatcaattcctacctcaaacccatgctccaaagg
gacttcatcactgcactgccagctcagggtctggaccacatagcggagaacatcctgtcg
ttcttggatgcgcgttctctctgctcggcagagctggtgtgtaaggagtggcagagggtc
atctcagagggcatgctgtggaagaaactcatagagcgtatggtccgtacagaccccctc
tggaaaggcctgtcagagaggcaccagtgggagaagtacttgttcaaaaatcgaaccaca
gaagtcccaccaaactcctactaccgctccctttaccccaaaatcatccaggacatagag
acgatcgaggctaactggaggtgtggtcggcacaatctgcagcggatccagtgtcgctca
gagaacagtaagggggtttactgtctgcagtatgatgacgacaagatcatcagcggcctc
cgagacaactccattaagatctgggataagcagtctttggagtgtctgaagatcctgaca
ggtcatacaggctcagtgttgtgcctgcagtatgatgagcgggtcatcgtcaccggctcc
tcagactccactgtcagggtgtgggatgtgaacactggggaggtgctgaacactctgatc
caccacaatgaggcggtcctccacttgcggttctgtaacggtctgatggtgacgtgctct
aaggaccgttccattgccgtgtgggacatggcctcacccaccgacatcagtctgcgccgc
gttctggtcggccacagagcagcggtcaatgtggtggacttcgatgacaagtacatcgtg
tcagcgtccggtgaccgtaccatcaaggtgtggagcaccagcacgtgtgagtttgttcgt
acgctgaacggccataagagaggcattgcctgtctgcagtacagagaccgactggtggtc
agtggctcatctgacaacactatccggttgtgggatattgagtgtggggcatgtttgcgc
gtattggaaggacatgaagagttggtccgctgcattcgattcgacaacaaaaggatcgtt
agtggagcctacgatggtaaaatcaaagtatgggacctgcaagctgctctggaccctcgt
gcccctgccagcaccctctgtctgcgcacactggtggagcattctgggcgtgtattccga
ctacagtttgatgagttccagattatcagcagttcccatgacgacaccatcctcatatgg
gatttcctgaacgtgtcgaccaatggacagactgagggccggtcgccctctcgcacgtat
acatacatctccagatag

KEGG   Salmo salar (Atlantic salmon): 106603254
Entry
106603254         CDS       T04363                                 

Gene name
FBW1B
Definition
(RefSeq) F-box/WD repeat-containing protein 11-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106603254 (FBW1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106603254 (FBW1B)
   04340 Hedgehog signaling pathway
    106603254 (FBW1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106603254 (FBW1B)
   04218 Cellular senescence
    106603254 (FBW1B)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106603254 (FBW1B)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     106603254 (FBW1B)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like Nup160 F-box F-box_4 WD40_2 DUF4508
Other DBs
NCBI-GeneID: 106603254
NCBI-ProteinID: XP_014052125
UniProt: C0H9X6
LinkDB
Position
ssa04
AA seq 526 aa
MEPEMEDKTLELMNTTFMDSQTDDLSSKKITVFKTITNGPTTGSRKRPSEGNYEKEKDVC
VQLFDQWSEADQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENIL
SFLDSRSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRT
TEVPPNSYYRSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISG
LRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVLNTL
IHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYI
VSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACL
RVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVF
RLQFDEFQIISSSHDDTILIWDFLNVSTNGQTEGRSPSRTYTYISR
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggagccggagatggaggacaaaacgttggagctgatgaacaccactttcatggactcc
cagacagatgacctctcatcaaagaagatcacagtgttcaagacgatcactaacggtccg
acgacgggctcaaggaagcggccatcggaagggaactatgagaaggagaaggacgtgtgc
gtccagctgtttgaccagtggtctgaggctgaccaagtggagtttgtggaacacctgatt
tcacgcatgtgccactaccaacacggccacatcaactcctacctcaaaccaatgctccaa
agggacttcatcactgcactgccagctcagggtctcgaccacatagcggagaacatcctg
tccttcctggactcgcgctcgctgtgctcggcagagctggtctgtaaggagtggcagagg
gtcatctcggagggaatgctgtggaagaaactcatagaacgcatggtccgtacagacccc
ctctggaaaggcctgtcagagaggcaccagtgggaaaagtacctgtttaagaatcgaacc
acagaagtcccaccaaactcctactaccgctccctgtaccccaaaatcatccaggacata
gagacgatcgaggctaactggaggtgtggtcggcacaatctgcagcggatccagtgtcgc
tcggagaacagtaagggggtttactgtctgcagtatgacgacgacaagatcatcagcggc
ctcagagacaactccatcaagatctgggacaagcagtctctggagtgtctgaagatcctg
acgggtcatacaggctcagtgttgtgtctgcagtatgatgagagggtcattgtcaccggg
tcctcagactccaccgtcagggtgtgggatgtgaacactggggaggtgctgaacactctg
atccaccacaacgaggcggttctccacttgcggttctgtaacggtctgatggtgacgtgc
tcgaaggaccgttccatcgccgtgtgggacatggcctcgcccacagacatcagtctgcgc
cgcgtgctggtcggccacagagcagcggtcaacgtggtggactttgacgacaagtacatc
gtgtcagcgtccggtgaccgtaccatcaaggtgtggagcaccagcacgtgcgagtttgta
cgtacgctgaacggccataagcgaggcatcgcctgtctgcagtacagagacagactagtg
gtcagcggctcctcggacaacactatccggttgtgggatattgagtgcggggcatgtttg
cgggtattggaaggccatgaagagttggtccgctgtattcgattcgacaacaaaaggatc
gttagcggagcctacgatggtaaaatcaaagtatgggacctacaagctgctctggatcct
cgcgcccctgccagcaccctctgtctgcgcacactggtggagcactctgggcgtgtattc
aggctacagtttgatgaattccagatcatcagcagttcccatgacgacactatcctcatc
tgggacttcctgaacgtgtcgaccaatggacagactgagggcaggtcgccctctcgcacg
tatacatacatctccagatag

KEGG   Salmo salar (Atlantic salmon): 106604789
Entry
106604789         CDS       T04363                                 

Definition
(RefSeq) F-box/WD repeat-containing protein 11-like
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106604789
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106604789
   04340 Hedgehog signaling pathway
    106604789
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106604789
   04218 Cellular senescence
    106604789
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106604789
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     106604789
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like F-box Nup160 F-box_4 DUF1098
Other DBs
NCBI-GeneID: 106604789
NCBI-ProteinID: XP_014055299
UniProt: A0A1S3RU93
LinkDB
Position
ssa05
AA seq 564 aa
MEPEIEDKTLELMCSVPRSLWLGCSSVAESLCALRCLQSIPSTRAHNQNTSVMESQNHID
DLSPKKTTVLTKLSNGPVMTGSRKRPSEGNNDKEKEHCIALFDQWSETDQVEFVEHLISR
MCHYQHGHINSYLKPMLQRDFITALPAQGLDHIAENILSFLDAQSLCSAELVCKEWQRVI
SEGMLWKKLIERMVRTDPLWKGLSERHQWEKYLFKNRTTEVPPNSYYHSLYPKIIQDIET
IEANWRCGRHNLQRIQCRSENSKGVYCLQYDDDKIISGLRDNSIKIWDKQSLECLKILTG
HTGSVLCLQYDERVIVTGSSDSTVRVWDVTSGEVLNTLIHHNEAVLHLRFCNGLMVTCSK
DRSIAVWDMASPTDISLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRT
LNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVS
GAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWD
FLNVSTNGQSEGRSPSRTYTYISR
NT seq 1695 nt   +upstreamnt  +downstreamnt
atggagccggagattgaggacaaaacgttggaattaatgtgctctgtgcctcgctctctc
tggctgggctgctcctcggtggcagagagtttgtgtgcactcaggtgcctgcagagcatc
ccctccacccgggcacacaaccagaacacatcagtcatggagtctcagaaccacatagac
gacctctcgccaaagaagaccacagttctcaccaagcttagtaacggtcctgtgatgacg
ggctctcgtaagcgcccgtcggaggggaacaacgacaaggagaaggagcactgcatcgcc
ctctttgaccagtggtccgagactgaccaagtggagtttgtagaacacctcatctcccga
atgtgccactaccaacacggccacatcaactcctacctcaaacccatgctccaacgagac
ttcatcacagcactgccagcccagggtctggaccacatagcagagaacatcctgtcgttc
ctggacgcgcagtctctgtgctcggcggagctggtgtgtaaggagtggcagagggtgatc
tcggagggcatgctctggaagaaactcatagaacgcatggtccgcacagaccccctctgg
aaaggcctgtcggagaggcaccagtgggagaagtatctgttcaagaaccgaacgacagag
gtcccgcccaactcctactaccactccctgtaccccaagatcatccaggacatagagact
atcgaggctaactggcggtgtggcagacacaacctgcagaggatccagtgtcggtcagag
aacagtaaaggagtctactgcctccagtacgacgacgataagatcatcagcggcctgaga
gacaactccataaagatctgggacaagcagtctctggagtgtctgaagatcctgacaggt
catacagggtcagtgttgtgtctgcagtatgatgagagggttatagtcactggttcctcc
gactccactgtcagggtgtgggacgtgacgtcgggcgaggtattgaataccctgatccat
cacaacgaagcggtgctccacctgcgcttctgcaacggtctgatggtgacgtgttccaag
gaccgctccatcgccgtgtgggacatggcctcgcccaccgacatcagcctccggcgggtc
ctcgtgggtcaccgcgccgccgtcaacgtggtcgattttgacgacaaatacattgtgtcg
gcgtcaggggaccgcaccatcaaggtgtggagcaccagtacgtgtgagtttgtgcgcacg
ctaaatggacacaagcgaggcatcgcctgcctgcagtacagagacagactggtggtcagc
ggctcctcagacaacaccatacggttatgggatattgagtgtggagcgtgtttgcgagtg
ttggaaggtcatgaggaactggtccgctgcattcgctttgacaacaagaggattgtcagt
ggtgcctatgacggtaagatcaaggtgtgggacctgcaagctgccctggacccacgagcc
ccagccagcaccttgtgtctgcgcacactggtggagcactcggggcgcgtgtttcggctg
cagtttgacgagttccagatcatcagcagttcccatgacgacaccatcctcatctgggac
ttcctgaacgtgtcgaccaatggacagtcagagggccggtccccctcacgcacctacacc
tatatctccagatag

KEGG   Salmo salar (Atlantic salmon): 106611815
Entry
106611815         CDS       T04363                                 

Gene name
FBW1B
Definition
(RefSeq) F-box/WD repeat-containing protein 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106611815 (FBW1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106611815 (FBW1B)
   04340 Hedgehog signaling pathway
    106611815 (FBW1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106611815 (FBW1B)
   04218 Cellular senescence
    106611815 (FBW1B)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     106611815 (FBW1B)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     106611815 (FBW1B)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like WD40_like Nup160 F-box F-box_4
Other DBs
NCBI-GeneID: 106611815
NCBI-ProteinID: XP_014067880
UniProt: A0A1S3SU57
LinkDB
Position
ssa09
AA seq 593 aa
MTSLHLQAADAGLGFYFHSRDSGGNNNMEPEMEDNTLELMSSVPRSLWLGCSSVAESLCA
LRCLQSIPSTRAHNQNTSVMESQNHVDDLSPKKTTVLTKLSNGPVMTGSRKRPSEGNCDK
EKEKEQCIALFDQWSETDQVEFVEHLISHMCHYQHGHINSYLKPMLQRDFITALPAQGLD
HIAESILSFLDAQSLCSAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERHQWEK
YLFKNRTTEVPPNSYYHSLYPKIIQDIETIEANWRCGRHNLQRIQCRSENSKGVYCLQYD
DDKIISGLRDNSIKIWDKQSLECLKILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVTS
GEVLNTLIHHNEAVLHLRFCNGLMVTCSKDRSIAVWDMASPTDISLRRVLVGHRAAVNVV
DFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWD
IECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLV
EHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVSTNGQSEGRSPSRTYTYISR
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgacgtctctgcatctgcaggccgccgacgcagggttgggtttctatttccacagccga
gattcgggggggaacaacaacatggagccggagatggaggacaacacgttggaattaatg
agctctgtgcctcgctctctctggctgggctgctcctcggtggcagagagtttgtgtgcg
ctcaggtgcctgcagagcatcccctctacccgggctcacaaccagaatacgtcagtgatg
gagtcccagaaccacgtagacgacctctccccaaagaaaaccacagttctcaccaagctt
agtaatggtcctgtaatgacaggctctcgtaagcgtccgtcagaggggaactgtgacaag
gagaaggagaaggagcagtgcatcgccctgtttgaccagtggtctgagactgaccaggtg
gagtttgtagaacacctcatctcccatatgtgccactaccaacacggccacatcaactcc
tacctcaaacccatgcttcaacgtgacttcatcacagcactgccagcccagggtctggac
cacatagcagagagcatcctgtcgttcctggacgcgcagtctctgtgctcggcagagctg
gtgtgtaaggagtggcagagggtgatctcggagggtatgctctggaagaaactcatagaa
cgcatggtccgcacagaccccctctggaaaggcctgtcagagaggcaccagtgggagaag
tatctgttcaagaaccgaacaacagaagtcccgcccaactcctactatcactcgctctac
cccaagatcatccaggacatagagactatcgaggctaactggcggtgtggcagacacaac
ctacagaggatccagtgtcggtcagagaacagtaaaggagtctactgcctccagtacgac
gacgataagatcatcagtggccttagagacaactccataaagatctgggacaagcagtct
ctggagtgtctgaagattctgacaggtcatacaggctctgtgctgtgtctgcagtatgat
gagcgggtcatagtcactggctcctccgactccactgtcagggtgtgggacgtgacttca
ggtgaagtactcaacactctgatccatcacaacgaggcggtgctccacctgcgcttctgt
aacggtctgatggtgacgtgttccaaggaccgctccatcgccgtgtgggacatggcctcg
cccaccgacatcagcctccggcgggtcctcgtggggcaccgcgccgccgtcaacgtggtc
gacttcgacgacaaatacattgtctcggcgtctggagaccgcaccattaaggtgtggagc
accagtacgtgtgagtttgtgcgcacactaaacggacacaagcgaggcatcgcctgcctg
cagtacagagacagactagtggtcagcggctcctcagacaacaccatacggttatgggat
attgagtgtggcgcgtgtttgcgggtgttggagggtcatgaggaactggtccgctgcatt
cgcttcgacaacaagaggatcgtcagtggtgcctacgacggtaagataaaggtgtgggat
ctgcaagctgctctggatccacgagccccagccagcaccttgtgcctgcgcaccctggtg
gagcactcgggacgtgtgttccggctgcagttcgacgagttccagatcatcagcagttcc
catgacgacaccatcctcatctgggacttcttgaatgtgtcgaccaatggccagtcagag
ggccggtccccctcacgaacctacacctatatctccagatag

DBGET integrated database retrieval system