KEGG   Salmo salar (Atlantic salmon): 106568489
Entry
106568489         CDS       T04363                                 

Gene name
shc3
Definition
(RefSeq) SHC adaptor protein 3
  KO
K17448  SHC-transforming protein 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106568489 (shc3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106568489 (shc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106568489 (shc3)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 106568489
NCBI-ProteinID: XP_013994357
UniProt: A0A1S3LTT4
LinkDB
Position
ssa13
AA seq 710 aa
MLHRTKYNRFRNESVTSVDDLHGLTMNPKVSAAPASSAEPPYTPPAAPSEGGVNHHHHPA
ADPSDDGATTLCTLINKVSNLKFTNSGSSLLGIKSLPSHVKDLTLSKLQGAGGSGGGSSG
GSSCIGSGSGSSVSLAASGGGNGGGSGGNGSSCGSASSISHHHHPPCSHSHSSQQEPGTM
SNAGGKKGSRLGLEEREAGQRQGHGGEDWGPSGGGGGGGGGGGGNSGLVNKPCSRGWLHS
SEKISGPGVTYIVKYLGCIEVLRSMKSLDFNTRSQITREAISLVCEAVPGAKGALRKRKP
PSKALSSILGKSNLQFAGMSINLNISTSSLNLMTPDSKQIIANHHMQSISFASGGDPVSD
PDTTHYVAYVAKDPVNRRACHILECCDGLAQDVISTIGQAFDLRFQQYLQCPSSKMTSVH
DRVLNMESVWTEEEEEEPADHPYYNNIPGKMPPPGGFIDTRLGQSIQAEQAPGAGVDQTY
YQGRHCGEIWGADRRPTGILVQQGSCDIYSLPEGKSTAPKTGDVPTYVNTQQIDAQVLAA
LQAEQDSMAAEGATGTAAKESPRKDLFDMKPFEDAILTQSAVPALHKAGSVDNSSPLLVR
SAAFKAQEELEGQAWYHGEMSRRDAEKLLVDDGDFLVRKSTTNPGSYVLTGMHNGLAKHL
LLVNPEGTVRTKDHIFDSISHLIGHHRDNSLPIVSAGSELCLKQPVGNRK
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgcttcaccgtaccaaatacaacagattcaggaatgagtcggtgacgtccgtcgatgat
ctacacggcctcaccatgaaccccaaggtctcggcagcccctgcgtcctccgccgagccc
ccgtacacccctcctgcagcgccatccgagggcggcgtgaaccaccaccaccaccccgct
gccgacccctcagacgatggagccaccaccctgtgcaccctcatcaacaaggtgtccaac
ctgaaattcaccaactcaggctccagcctgctgggtatcaagagcctcccctcccacgtc
aaggacctgaccctctccaagctgcaaggtgctggaggctccggtggtggatcaagcggt
ggctccagctgcattggtagcggctctggctccagtgtgtcgttggcagcctccggtggt
ggtaacggtggtggcagtggcggtaacggctcctcctgtggctcagcctccagcatctcc
caccaccaccaccccccctgctcccactcccactcctcccagcaagagccaggcaccatg
agcaacgcagggggaaagaagggcagcaggttggggctggaagagagggaggctgggcag
agacagggacatggaggggaggactggggacctagtggaggaggaggaggtggaggtgga
ggaggaggaggtaacagtggactggtgaataaaccctgttccagaggatggctgcattcc
agtgagaagatctctggacccggagtgacgtacattgtaaagtatttgggttgcattgaa
gtccttcggtcgatgaaatcactggatttcaacacgagatcgcaaataacaagagaggcc
atcagcttggtgtgtgaggcagtcccgggggccaaaggagcgctgcggaagagaaagcct
ccatctaaagccctgtccagtatcttggggaagagtaacctccagtttgctgggatgagc
atcaacttgaatatctccaccagcagcctcaacctgatgaccccagactccaaacagatc
atagccaatcatcatatgcagtccatttcctttgcatcgggaggagatccagtgagtgat
ccagacacgactcattatgttgcctatgtagcaaaagatcctgtcaaccgaagagcgtgt
catattctggagtgttgtgatggtctggcccaggatgtgatcagcaccatcggccaggcc
tttgacctccgtttccagcagtacctccagtgtccctccagcaagatgacctctgtacac
gacagggttctgaatatggagtcagtctggacagaggaggaggaggaggagcctgctgat
catccatactacaacaacatccccggcaagatgccaccacctggagggttcatagacacc
cggctaggccagagcatccaggctgagcaggccccaggggctggggtggaccagacttac
taccagggtagacactgtggcgagatctggggagcggacaggaggcctactgggatactc
gtccaacagggatcatgtgacatctacagtctgccggaggggaagagcacagcaccaaaa
acgggggatgtgcctacgtacgtgaacacccagcagatcgacgcccaggtgctggcagcg
ctgcaggctgaacaggacagcatggcagcagaaggggcaacgggcacagcagccaaagaa
agtccaaggaaagacctgttcgacatgaagccttttgaggatgccatcctgacccagtca
gcggtccctgcccttcacaaggctggatctgtggataactccagccccttgttggtgcgc
tctgctgccttcaaggcccaggaggagctggaaggccaggcctggtaccacggagagatg
agccgacgagacgcagagaaactactggtagacgacggagacttcctggttaggaagagc
accaccaaccctgggtcgtacgtactgacgggcatgcacaatgggctggccaaacaccta
ctgctggtgaatcctgagggcacggtgcggacaaaagatcacatatttgacagcatcagt
cacctgataggccatcaccgtgacaacagcttacccatagtgtctgcaggaagtgaactt
tgtctgaagcagcctgtgggcaacaggaaatag

KEGG   Salmo salar (Atlantic salmon): 106575570
Entry
106575570         CDS       T04363                                 

Definition
(RefSeq) SHC-transforming protein 1-like
  KO
K06279  SHC-transforming protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106575570
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106575570
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106575570
SSDB
Motif
Pfam: PID SH2 PGM_PMM_IV
Other DBs
NCBI-GeneID: 106575570
NCBI-ProteinID: XP_014007632
UniProt: A0A1S3MWR6
LinkDB
Position
ssa02
AA seq 457 aa
MEYVDMNRLGGASRRARVEGGQLGGDEWTRHGSFVNKPTRGWLHSDLVVSTTGVAYSVRY
MGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRKRKPSSRCMTSILGKRNLQ
FAGMTISLTVSTSSLNLLASDCKQIIANHHMQSISFASGGDPVSHTALSLTHSPHYPSSI
PTLFILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAPFDGSAWEEEEDEG
APPPADVPYYNNFPGKQPPPGGLVDMRARPGATLPYGQPGQNDIHKQPLPPLPMGAKEGG
RDLCDDPSYVNVDKPRPTTAAVNGNAHRDAFDMKPFDDSLGVSGLGVSAAPPLVEQLQCE
AWFHGSLSRRQAERLLTRDGDFLVRESGTTPGQYVLTGQQGGQPKHLLLVDPEGVVRTKD
HHFESVSHLISYHMDNRLPIVSAGSEVCLQQPVEHRA
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggaatacgtggatatgaaccggctgggtggggcgtccaggagggcgcgggtggagggg
gggcagctggggggagatgagtggacgcgccacggctccttcgttaacaagcccaccaga
ggatggctacactcagaccttgtggtcagcaccactggggttgcctactcagtacggtat
atgggctgtgtggaggtgctacagtctatgagggcactggacttcaacaccagaactcag
gtcaccagagaggctatctcagtggtgtgtgaggcagtgcctggagccaaaggagcccaa
cgcaagagaaagccgtcgtctcgctgtatgacgtccattctggggaaacgtaacctgcag
tttgctgggatgaccatcagcctgacggtctctaccagcagcctcaacctgctggcctcc
gactgcaaacagataattgcaaatcaccacatgcagtccatctctttcgcttctggagga
gacccagtgagtcatacagccctctccctcactcactcacctcactatccatcctctatc
cccactctattcatcctggagtgttcggagggcttggcccaggaagttatcagtacgata
gggcaggccttcgaactacgcttcaaacagtacctgaagaacccccccaaactggtcacc
ccccatgacaggatggctccgtttgacggctcagcgtgggaggaagaggaagatgaggga
gcaccgccccctgcagatgttccgtactataataacttccccgggaaacaacctcctcct
gggggactggtggacatgagggcccgccctggggctacactgccctatggacagccgggt
cagaatgatattcacaagcagcctcttccccctctaccaatgggagcaaaggagggaggg
cgggacctgtgtgatgacccctcatacgtcaatgtggataaaccccgccccacaacagct
gcagtcaatggcaacgctcacagagatgcgttcgacatgaagccgtttgatgattccctg
ggtgtatcaggtctgggggtctcagcggcaccccctctggtggaacagctgcagtgtgag
gcctggttccacggcagcctgagtcgcaggcaggctgagagactgctgacccgtgatgga
gacttcctggtccgagagtcaggcaccacccctggacagtacgtcctcactggacaacag
gggggtcagcccaaacacctactactggtcgacccagagggagtggtacgtaccaaagac
caccactttgagagtgtgagccacctgatcagttaccacatggacaacagactgcccatc
gtatcagcaggcagtgaggtgtgtctgcaacaaccagtggagcacagggcctga

KEGG   Salmo salar (Atlantic salmon): 106584416
Entry
106584416         CDS       T04363                                 

Definition
(RefSeq) SHC-transforming protein 2-like
  KO
K17447  SHC-transforming protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106584416
   04370 VEGF signaling pathway
    106584416
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584416
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106584416
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 106584416
NCBI-ProteinID: XP_014025189
UniProt: A0A1S3PC31
LinkDB
Position
ssa23
AA seq 713 aa
MLLKPKYGRFRNASVTSSDDLMQSLAMSGKVVATPVVLSSAPSLPLPPLPPLESIPGSSS
AAPALADSPCLDGEQDATTTFCMLIPRMPQWKFSNTLLSRSPSNSSSSKDSGKTAAPSSQ
GSHGPSGPSVPSGPVASLAAVLNSCDPVCVTPCSLQAISRQRSAMRSASPGGHGAGAAEG
TGSPGGHNGFRTGMNRRTRVEGMWLGGEDFNQKGSFIHKPSQGWLHPDKNITGPGASYIV
RYMGCIEVLKSMRSLDFNTRTQVTREAINRLCESVPGSKGAWRKKNINKALQSIMGKSNL
RFAGMSIAVNISIEGLNLLIPTTRQVIAHHPMQSISFASGGDTDTPDYVAYVAKDPVNQR
ACHILECCDGLAQNVISTIGQAFELQFKQYLHSPPKAIPTMERNIRTEDSAWGDDEDSSE
HDYYNSIPGKEPPVGGVVDSRLRPCTALLGHVHSQPQSKAVQMGSPARRDTASYPSGQLC
YELHWDTENNGSSGLTSDGYLRADGHPPGSRYYEEHLYVNTQSLEGLEQGAEGHRGARGP
DSPKKDIFDMKPFEDALKMHEAGGNGGVRVLEDQWPSPPRRRAPVAPTEEQLRREAWYHG
RMSRRDAEKLLVRDGDFLVRDSATNPGQYVLTGMHCGLPKHLLLVDPEGMPTPPRHCQVR
TKDMLFESISHLISYHLKNELPIVAAESELHLKQVVRRKEGTAFWNGVRGVSI
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgctacttaagccaaagtatggccgctttcgcaacgcctctgtgacctcctccgacgac
ctgatgcagagcttagccatgagcggcaaagtggtggccaccccggtggtcctttcctcc
gcccccagtctgccgctgccccccctgcctcctctggagtccatccccgggtcctcctcc
gcagccccggccctggccgactccccctgcctggacggggagcaggacgccaccaccact
ttctgcatgctcatccccaggatgcctcagtggaagttctccaacactctgctgagcagg
agcccctctaactccagctccagcaaggactccggcaagacagcagccccctcatcgcag
ggctcgcacggccccagtggcccttctgtccccagtggtcccgtggcaagtctggccgct
gttttgaactcctgtgaccctgtgtgtgtcaccccctgttccctacaggccatcagcagg
cagagatctgcaatgcgctcagccagtccagggggccacggagcaggggctgcagagggc
acagggagccctgggggccacaacggcttcaggacagggatgaaccgcaggaccagggtg
gagggcatgtggctgggaggggaggacttcaaccagaagggcagcttcatccacaagccc
tcccaaggatggctgcacccagacaagaacatcacaggccctggggcctcctacattgtc
aggtacatgggctgtattgaggtgttgaagtcgatgcgatcgctggacttcaacactcgg
acccaggtgacgagggaggccatcaacagactgtgtgaatctgtgcctgggagtaagggg
gcctggaggaagaagaacattaacaaggccctgcagtccatcatggggaagagtaacctg
cgcttcgctggtatgagcatcgctgtcaacatctctatagagggcctcaacctgctcatc
cccaccacacgacaggtgatagcacaccatcccatgcagtccatctcctttgcctctggg
ggagacacggacacgcccgattatgttgcttatgtggccaaagatccagtcaatcagaga
gcatgccatatcctggagtgttgtgacggtctagcccagaatgtcatcagtaccatcggc
caggcctttgaactgcagtttaaacagtatctccacagccctcccaaagccatccccacc
atggagaggaacatcaggacagaggactcggcgtggggtgatgacgaggactcctcggag
catgactactacaacagcatcccagggaaggagcctcctgttggaggagtggtggactcg
aggctgaggccttgtacggccttgctgggccacgtccacagccaaccacagagcaaggca
gtgcagatgggttctccggccaggagagacactgcgtcctacccctcaggtcagctgtgc
tacgagcttcactgggacactgagaacaacggcagctcaggtctgacatcagatgggtac
ctgcgggcagatggccatcccccgggaagtaggtactatgaagagcacctgtatgtgaac
acccagagtctggagggcctggagcagggagcagagggccataggggggccagggggcca
gacagccccaagaaagacatatttgacatgaaaccctttgaggatgctctgaagatgcac
gaggccggtggtaacggtggggtgcgtgtgttggaggaccagtggcccagtccgccccgg
cgtcgtgcccctgtcgcccccacagaggagcagcttcggcgggaggcctggtaccatggc
cgtatgagccgccgggacgctgagaaactgctggtccgagacggggacttccttgtacga
gacagtgccaccaacccaggccagtacgtcttgacgggcatgcactgcggtctgcccaaa
cacctgctactggtcgacccagagggaatgcccactcctccccgtcactgccaggtacga
accaaagacatgctgtttgagagtatcagtcacctgatcagctaccacctgaagaacgag
ctgcccatcgtggcagccgagagcgagctgcacctcaaacaggtggtccggaggaaagag
gggacagcgttctggaatggagtcagaggtgtgtccatataa

KEGG   Salmo salar (Atlantic salmon): 106593005
Entry
106593005         CDS       T04363                                 

Definition
(RefSeq) SHC-transforming protein 1-like
  KO
K06279  SHC-transforming protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106593005
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106593005
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106593005
SSDB
Motif
Pfam: PID SH2 PGM_PMM_IV Chordopox_A33R
Other DBs
NCBI-GeneID: 106593005
NCBI-ProteinID: XP_014039826
UniProt: A0A1S3QIK1
LinkDB
Position
Un
AA seq 590 aa
MMELVPKTKYTHFRSESLSSNDDTNSNPFSLPPSTPATPLTPPGLPSSLSSSSLTPILPP
SSPRRAENSPTTLCSFFPRMGALRLGISAALLPGLKVSSRPQRAQAPMGSSGGNSSSSPT
PHPPPCLTAPSPPHRPFLQDMNRLGGASRRARVEGGQLGGDEWTRHGSFVNKPTRGWLHS
DLVVSTTGVAYSVRYMGCVEVLQSMRALDFNTRTQVTREAISVVCEAVPGAKGAQRKRKP
SSRCMTSILGKRNLQFAGMTISLTVSTSSLNLLASDCKQIIANHHMQSISFASGGDPDTA
EYVAYVAKDPVNQRACHILECSEGLAQEVISTIGQAFELRFKQYLKNPPKLVTPHDRMAP
FDGSAWEEEEDEGAPPPADVPYYNNFPGKQPPPGGLVDMRARPGATLPYGQPGQNDIHKQ
PLPPLPMGAKEGGRDLCDDPSYVNVDKPRPTTAAANGNAHRDAFDMKPFDDSLGVSGLGV
SAAPPLVEQLQCEACFHGSLSRRQAERLLTRDGDFLVRESGTTPGQYVLTGQQGGQPKHL
LLVDPEGVVRTKDHHFESVSHLISYHMDNRLPIVSAGSEVCLQQPVEHRA
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgatggagctggtccctaaaactaagtacactcacttccggagtgaatctctcagttcg
aatgacgataccaactccaaccctttctccctccccccttccacccccgcaacccccctc
acccctcctgggctaccctcctccctctcctcctcctctctcacccccatcctcccccct
tcctccccccgccgggctgagaacagccccaccacgctctgttccttcttccccaggatg
ggagcccttcgcctgggcatctctgccgctctactcccaggcctcaaggtctccagcagg
cctcagcgggctcaagcccccatggggtcttcagggggtaacagttccagctctcccact
cctcacccccctccctgtctaacagccccctctcccccccatcgcccctttctgcaggat
atgaaccggctgggtggggcgtccaggagggcgcgggtggagggggggcagctgggggga
gatgagtggacgcgccacggctccttcgtcaacaagcccaccagaggatggctacactca
gaccttgtggtcagcaccactggggttgcctactcagtacggtatatgggctgtgtggag
gtgctacagtctatgagggcgctggacttcaacaccagaactcaggtcaccagagaggct
atctcagtggtgtgtgaggcagtgcctggagccaaaggagcccaacgcaagagaaagccg
tcgtctcgctgtatgacgtccattctggggaaacgtaacctgcagtttgctgggatgacc
atcagcctgacggtctctaccagcagcctcaacctgctggcctccgactgcaaacagata
attgcaaatcatcacatgcagtccatctctttcgcttctggaggagacccagacacagca
gagtatgtagcatacgtggccaaagacccagtcaaccagagagcgtgtcatatcctggag
tgttcggagggcttggcccaggaagttatcagtacgatagggcaggccttcgaactacgc
ttcaaacagtacctgaagaacccccccaaactggtcaccccccatgacaggatggctccg
tttgacggctcagcgtgggaggaagaggaagatgagggagcaccgccccctgcagatgtt
ccgtactataataacttccccgggaaacaacctcctcctgggggactggtggacatgagg
gcccgccctggggctacactgccctatggacaaccgggtcagaatgatattcacaagcag
ccgcttccccctctaccaatgggagcaaaggagggagggcgggacctgtgtgatgacccc
tcatacgtcaatgtggataaaccccgccccacaacagctgcagccaatggcaacgctcac
agagatgcgttcgacatgaagccgtttgatgattccctgggtgtatcaggtctgggggtc
tcagcggcaccccctctggtggaacagctgcagtgtgaggcctgcttccacggcagcctg
agtcgcaggcaggctgagagactgctgacccgtgacggagacttcctggtccgagagtca
ggcaccacccctggacagtacgtcctcactggacaacaggggggtcagcccaaacaccta
ctactggtcgacccagagggagtggtacgtaccaaagaccaccactttgagagtgtgagc
cacctgatcagttaccacatggacaacagactgcccatcgtatcagcaggcagtgaggtg
tgtctgcaacaaccagtggagcacagggcctga

KEGG   Salmo salar (Atlantic salmon): 106613792
Entry
106613792         CDS       T04363                                 

Definition
(RefSeq) SHC-transforming protein 2-like
  KO
K17447  SHC-transforming protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613792
   04370 VEGF signaling pathway
    106613792
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613792
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613792
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 106613792
NCBI-ProteinID: XP_014071883
UniProt: A0A1S3T5M0
LinkDB
Position
ssa10
AA seq 703 aa
MLLKPKYGRFRNDSVTSSDDLMQSLAMSGKVVATPVVLSSAPSLPLPPLPPLESIPRSSS
AAPALADSPCLDGEQDATTTFCMLIPRMPQWKFSNSLLSRSPSNSNSSKDSGKAAAPSSQ
GSHSPSGTSAPNGPVASLASVLNSCDPVCVNPCSLQAISRQRSAAGSASPGGHAAGAAEC
TGSPGGHSGSRAGMNRRTRVEGMWLGGEDFNQKGSFIHKPSQGWLHPDKKITGPGASYIV
RYMGCIEVLKSMRSLDFNTRTQVTREAINRLCEAVPGGKGAWRRKNINKALQSIMGKSNL
RFAGMSIAVNISIEGLSLLIPTTRQVIAHHPMQSISFASGGDTDTPDYVAYVAKDPVNQR
ACHILECCDGLAQNVISTIGQAFELQFKQYLHSPPKAIPTMERNIRTEDSAWGDDEDSLE
HDYYNSIPGKVPPFGGVVDSRLKPCTALLGHVHSQPESKAVQMGSPSRRDTASCPSGQLC
YELHWDTENNSSSGLTSDGYQRADGQPPGSRDYEEHLYVNTQSLEGLEQGAEGHRGDWGP
DSPMKDIFDMRPFEDALKMHEAGGVGGNGGVCVLKDQWPSPPRRRAPVAPTEEQLRREAW
YHGRMSRRDAEKLLVRDGDFLVRDSATNPGQYVLTGMHCGLPKHLLLVDPEGVPTPPRHC
QVRTKDMLFESISHLISYHLKNELPIVAAESELHLKQVVQRKQ
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgctacttaagccaaagtatggccgctttcgcaacgactctgtgacctcctccgacgac
ctgatgcagagcttagctatgagcggcaaagtggtggccaccccggtggtcctctcctcc
gcccccagcctgccacttccccccctgcctcctctggagtccatcccccggtcctcctct
gcagcccctgctctggccgactccccctgcctggacggggagcaggacgccaccaccact
ttctgcatgctcatccccaggatgcctcagtggaagttctctaactcgctgctcagtagg
agcccctccaactccaactccagcaaggactcgggcaaggctgcagccccctcatcgcag
ggctcgcacagccccagtggaacttctgcccccaatggtcctgtggccagtctggcttct
gttttgaactcctgtgaccctgtgtgtgtcaacccctgttctctacaggccatcagcagg
cagagatctgcagcgggctcagccagtccaggtggccacgccgcaggggctgcagagtgc
acagggagccccgggggccacagcggatccagggcggggatgaaccgcaggacaagggtg
gagggcatgtggctgggaggggaggacttcaaccagaagggcagcttcatccacaagccc
tcccagggctggctgcacccagacaagaagatcacaggccctggggcttcctacatagtc
aggtacatgggctgtattgaggtgttaaagtcgatgcgatcgctagacttcaacactcgg
acccaggtgacgagggaggccatcaacagactgtgtgaagctgtgcctgggggtaaaggg
gcctggaggaggaagaacattaacaaggccctgcagtccatcatggggaagagtaacctg
cgcttcgctggtatgagcatcgctgtcaacatctctatagagggtctcagcttgctcatc
cccaccacacgacaggtgatagcacaccatcccatgcagtccatctcctttgcctctggg
ggagacacggacacgcccgattatgttgcttatgtggccaaagatccagtcaatcagaga
gcatgccatatcctggagtgttgtgacggtttagctcagaatgtcatcagcaccatcggg
caggcctttgaactgcagtttaaacagtacctccacagccctcccaaagccatccccacc
atggaaaggaacatcaggacagaagactcggcgtggggagatgacgaggactcgttggag
cacgactactacaacagcatccctgggaaggtgcctccttttgggggagtggtggactca
aggctgaagccttgtacggccttgctgggccacgtccacagccaaccagagagcaaggca
gtgcagatgggttctccgtccaggagagacacagcttcctgcccttcaggtcagctgtgc
tacgagcttcactgggatactgaaaacaacagcagctcaggtctgacatcagatggttac
cagcgagcagatggccagcctccggggagcagggactatgaggagcacctatatgtgaac
acccagagtctggagggattggagcagggagcagagggccacaggggggactgggggcca
gacagccccatgaaagacatctttgacatgagaccctttgaggatgctctaaagatgcac
gaggctggtggtgtcggtggtaacggtggggtgtgtgttttgaaggaccagtggcccagc
ccgccccgacgtcgtgcccctgtcgcccctacagaggagcagctccggcgggaggcctgg
taccacggtcgtatgagccgccgtgatgctgagaaactgttggtccgagacggggacttc
ctggtacgagacagtgccaccaacccaggccagtatgtcctgacgggcatgcattgtggt
ctgcccaaacacctgctactggtggacccagagggagtgcccactcctcctcgtcactgt
caggtacgcaccaaagacatgctgtttgagagcattagtcacctgatcagctaccacctg
aagaacgagctgcccatcgtggcggccgagagcgagctgcacctcaaacaggtggtccag
aggaaacagtga

DBGET integrated database retrieval system