KEGG   Salmo salar (Atlantic salmon): 106568560
Entry
106568560         CDS       T04363                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106568560
   04012 ErbB signaling pathway
    106568560
   04310 Wnt signaling pathway
    106568560
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106568560
  09143 Cell growth and death
   04210 Apoptosis
    106568560
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106568560
   04530 Tight junction
    106568560
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106568560
   04621 NOD-like receptor signaling pathway
    106568560
   04625 C-type lectin receptor signaling pathway
    106568560
  09152 Endocrine system
   04912 GnRH signaling pathway
    106568560
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106568560
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106568560
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf Jnk-SapK_ap_N Phlebovirus_NSM Seryl_tRNA_N
Other DBs
NCBI-GeneID: 106568560
NCBI-ProteinID: XP_013994476
UniProt: A0A1S3LUD6
LinkDB
Position
ssa13
AA seq 357 aa
MTAKMETPFYDDEALGVPHNFGQHHADYQRYQGHKMMSKKVAHNFSGGSHSSSGLKLLQN
QPGSNCNINPNNLGGINSNTNSSLIPGGLSDMNLLKLASPDLEHLIIQSNQGLVTTSPVP
NPNGGNPFMYRNNATNEQEGFADGFVKALADLHKQNQLVGAPMSPSSSIQGPYQRNIMPA
GDLPIYTNLSSYNPNHPNHISSSYPGGQMHGGYPGHGPHGPGGQGSHHTHNRGPDAPQTV
PEIRHPPGDSTSSPPSLSPIDLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVK
VLKTQNCDLTSTASILREQVAQLKQKVMNHVTNGCQIAVSSAALQSKSTGDRESTSC
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgacggctaaaatggaaacccctttctacgacgacgaggctctaggtgttcctcacaac
ttcggacaacaccatgcagattaccaacgttaccagggccacaagatgatgagtaaaaaa
gtggcacataacttctcaggaggttcccacagcagctctggcctgaaactgttacaaaac
cagccggggagcaactgcaatatcaaccctaataacctgggagggattaacagcaacaca
aacagctccttaatacccggcggcttgtcagatatgaaccttctgaagctagcctcccct
gacctcgagcacctcatcatccagtctaaccagggcttggtgacgacgtctcccgtcccc
aaccctaacggaggtaaccccttcatgtaccggaacaacgccactaacgaacaggagggt
tttgccgatgggttcgtcaaagccctggcggatctccataagcagaaccagctggttgga
gctcccatgtccccgtcctcctctatacaaggcccctaccagaggaacatcatgcctgca
ggagacctacccatctataccaacctcagcagctacaaccccaaccaccccaaccatata
tcatcttcctacccagggggtcagatgcacggcggctacccaggccacggaccccacgga
cccggaggccaagggtcccaccatacccacaacagaggcccggatgcccctcagactgtc
ccagagatacgtcaccctcccggggactccacctcctcccctccctcactgtctcccatc
gacctggagacccaggagaggatcaaagccgagaggaagaagctacgtaacaggatcgcg
gcgtctaagtgtcgtaaaaggaaactggagcggatctccaggctagaggagaaggtgaag
gttctgaagacccagaactgtgacctgacctccaccgcctcgatactgagggaacaggtg
gcccagctcaaacagaaagtcatgaatcacgtcaccaacggttgccagatagcagtcagc
tcagcagccctgcagtccaagagcaccggggacagggagagcaccagctgctga

KEGG   Salmo salar (Atlantic salmon): 106569413
Entry
106569413         CDS       T04363                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106569413
   04012 ErbB signaling pathway
    106569413
   04310 Wnt signaling pathway
    106569413
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106569413
  09143 Cell growth and death
   04210 Apoptosis
    106569413
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106569413
   04530 Tight junction
    106569413
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106569413
   04621 NOD-like receptor signaling pathway
    106569413
   04625 C-type lectin receptor signaling pathway
    106569413
  09152 Endocrine system
   04912 GnRH signaling pathway
    106569413
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106569413
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106569413
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 PspA_IM30 Takusan Jnk-SapK_ap_N Phlebovirus_NSM
Other DBs
NCBI-GeneID: 106569413
NCBI-ProteinID: XP_013996228
UniProt: A0A1S3LZ83
LinkDB
Position
ssa14
AA seq 321 aa
MPTKMEATLYDESVNGQQGAVGGYRGFNPKTLKQSMTLNLNDPKMFKPHLRAKAIDILTS
PDVGLLKLASPELERLIIQSCNGLTTPTPTQFLCPKNITDEQEGFAEGFVKALAELHYQQ
HMPNGSSDAQANAANDMAPSSTVSDSPIPYSCTVRPEPPEYTNLGTFSRAVSSASSLNGD
RHSSTSYTAVPSQIHIEPQRPSQHPRLQHARLQSFKEEPQTVPEMSGDTPPLSPIDMESQ
ERIKAERKRLRNRVAASKCRKRKLERISRLEDRVKNLKTQHTELVSSANVLRDELALLKQ
KVMDHVNSGCQLILTQQLQAF
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcccaccaagatggaagctacattatatgacgaatctgtaaatggtcagcaaggcgca
gtgggcggatatcgtgggtttaacccgaaaaccctgaagcagagcatgacactcaacctc
aacgaccctaaaatgtttaaacctcatctgcgggcgaaagctatcgacatcctgacatcc
cctgatgtgggattattaaaactggcttcccctgaattggaaaggcttatcatccagtcc
tgcaatgggctgacgacaccgaccccaactcagtttctctgtcccaagaacatcaccgac
gagcaagagggttttgccgagggattcgtaaaggcgctcgcggagcttcattatcaacag
catatgcccaatggcagctctgacgctcaagccaatgctgccaacgacatggcaccctca
tctactgtgtcggacagtcctataccctacagctgcaccgtgcgccccgagccacctgaa
tacacaaacttgggcactttcagtcgggctgtcagctctgcgtcgtcacttaacggcgac
agacactcctccactagttacacggccgtcccgtcccaaatccacatcgagccccagcgg
ccatcccagcatccacggctacagcatgctcggctacagtcattcaaagaggagccccag
acggtgcccgagatgagcggcgatacccctccgctgtctcctatcgacatggagagccag
gagcggataaaagccgagcgaaagcgcttgagaaacagggtggctgcgtccaaatgccgg
aaaaggaagctggagaggatctcgaggctggaggacagggtcaaaaacctgaagacccaa
cacacagagttggtctcctctgccaacgtgctccgggacgaactggcactgctaaaacag
aaggtcatggaccacgttaacagcgggtgccaactcatattgacgcaacagctccaggcg
ttctga

KEGG   Salmo salar (Atlantic salmon): 106572830
Entry
106572830         CDS       T04363                                 

Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106572830
   04012 ErbB signaling pathway
    106572830
   04310 Wnt signaling pathway
    106572830
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106572830
  09143 Cell growth and death
   04210 Apoptosis
    106572830
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106572830
   04530 Tight junction
    106572830
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106572830
   04621 NOD-like receptor signaling pathway
    106572830
   04625 C-type lectin receptor signaling pathway
    106572830
  09152 Endocrine system
   04912 GnRH signaling pathway
    106572830
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106572830
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106572830
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf PspA_IM30 Jnk-SapK_ap_N Seryl_tRNA_N BUD22
Other DBs
NCBI-GeneID: 106572830
NCBI-ProteinID: XP_014002815
UniProt: A0A1S3MIA9
LinkDB
Position
ssa01
AA seq 353 aa
MDTPFYHDEAPGIPHNFGQHHADYQRYQGHKMMSKKVAHNFSGGSHSSSGLKLLQNQPGS
NCNSNPNNLGGINSNTNSSLIPGCLSDMNLLKLASPDLEHLIIQSNQGLVTTSPVPNPNG
GNPFMYRNNATNEQEGFADGFVKALADLHKQNQLVGSPMSPSSSIQGPYQRNIMPVGDLP
IYTNLSSYNPNHPSHISSSYPGGQMPDVYPGHGPHGPGGQGSHHPHNRGPDAPQTVPEVP
HPPGDPTSSPPSLSPIDLETQERIKAERKKLRNRIAASKCRKRKLERISRLEEKVKVLKT
QNCDLTSTASILREQVAQLKQKVMNHVTNGCQIAVSSATLQANSTGDRESTSC
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggatacccctttctaccacgacgaagccccgggtattcctcacaatttcggacaacac
catgcagattaccaacgttaccagggccacaagatgatgagtaaaaaagtggcacataac
ttctcaggaggttcccacagcagctctggtctgaaactgttacaaaaccagccagggagc
aactgcaacagcaaccctaataacctgggagggattaacagcaacacaaacagctcctta
atacccggctgcttgtcagatatgaaccttctgaagctagcctcccctgacctcgagcac
ctcatcatccagtctaaccagggcttggtgacgacgtctcccgtccccaaccctaacgga
ggtaaccccttcatgtaccggaacaacgccactaacgaacaggagggttttgccgatggg
ttcgtcaaagccctggcggatctccataaacagaaccagctggttggatctcccatgtcc
ccgtcctcctctatacaaggcccctaccagaggaacatcatgcctgtaggagacctgccc
atctataccaacctcagcagctacaaccccaaccaccccagccatatatcatcatcatac
ccagggggtcagatgcccgacgtctacccaggccacggaccccacggacccggaggccaa
gggtcccaccatccccacaacagaggcccggatgcccctcagactgtcccagaggtccct
caccctcccggggaccccacctcctcccctccctcactgtctccgatcgacctggagacc
caggagaggatcaaagccgagaggaagaagctacgtaacaggatcgcggcgtcgaagtgt
cgtaaaaggaaactggagcggatctccaggctagaggagaaggtgaaggttctgaagacc
cagaactgtgacctgacctccaccgcctcgatactgagggaacaggtggcccagctcaaa
cagaaagtcatgaatcacgtcaccaacggttgccagatagcagtcagttcagccaccctg
caggccaacagcaccggggacagggagagcaccagctgctga

KEGG   Salmo salar (Atlantic salmon): 106584280
Entry
106584280         CDS       T04363                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584280 (JUN)
   04012 ErbB signaling pathway
    106584280 (JUN)
   04310 Wnt signaling pathway
    106584280 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106584280 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    106584280 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584280 (JUN)
   04530 Tight junction
    106584280 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106584280 (JUN)
   04621 NOD-like receptor signaling pathway
    106584280 (JUN)
   04625 C-type lectin receptor signaling pathway
    106584280 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106584280 (JUN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106584280 (JUN)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106584280 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB FlaC_arch DUF3450 Jnk-SapK_ap_N TEX13
Other DBs
NCBI-GeneID: 106584280
NCBI-ProteinID: XP_014024821
UniProt: A0A1S3PB80
LinkDB
Position
ssa23
AA seq 324 aa
METTFYDDSLNSFSQHEKPDYGYNPKALKHSMTLNLADPTSTLKPHLRAKASDILTSPDV
QLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFAEGFVRALAELHHQHV
LPNAPGGPVTSAGQTSINNPTIPPPVSALTVSSVYNNNITMRSESPVYEDLNTFTPAITT
NSALGYTTSAPAMSFPSAPPQLPVYGQQSHPHPRLTALKEEPQTVPEMPGETPPLSPIDM
ENQERIKAERKRMRNRVAASKCRKRKLERISRLEDKVKNLKTQNSDLASTANMLREQVAQ
LKQKVMNHVNSGCQLMLTQQLQTF
NT seq 975 nt   +upstreamnt  +downstreamnt
atggaaactaccttctatgatgactcgctcaactctttctcccagcatgagaaaccggac
tacggatacaaccccaaagcactgaaacacagcatgacactgaacctggccgacccaacc
agcacactcaaacctcacctccgggctaaagccagcgacatcctcacctctcctgacgtg
cagctcctcaaactggcctccccagagttggagcggctcatcatccagtctagcaacggc
ctgatcaccaccacacctaccccgacgcagttcctctgcccgaggaacgtaaccgatgag
caggagggctttgcggagggatttgttagagcactggcggagctccatcatcaacacgtc
ttgcccaatgcacccgggggcccagtcacatccgctgggcagacaagcatcaacaacccg
acaatacccccacctgtttccgccttgacagtgagcagtgtttataacaacaacataacc
atgcgctctgagtcgcctgtctacgaagacctgaacacgttcaccccggctatcaccacc
aactcagccctgggttacaccacttcagccccagctatgagctttccctctgcgccgcca
cagctccccgtctatgggcagcagtctcacccccaccccaggctcactgccctaaaagag
gagccccagacggtgcctgagatgcctggggagaccccccctctctctcccatcgatatg
gagaatcaggagaggatcaaagccgagaggaagcgcatgaggaaccgcgtcgccgcctcc
aagtgcaggaagcggaagctggagcgcatctcccggctggaggacaaggtgaagaacctg
aagactcagaactccgacctggcttccacagccaacatgctgagggaacaggtcgcccag
ctcaaacagaaggtgatgaaccatgtcaacagcggctgtcaactcatgctgacgcagcag
ctccagaccttctga

KEGG   Salmo salar (Atlantic salmon): 106600411
Entry
106600411         CDS       T04363                                 

Gene name
jun
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106600411 (jun)
   04012 ErbB signaling pathway
    106600411 (jun)
   04310 Wnt signaling pathway
    106600411 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106600411 (jun)
  09143 Cell growth and death
   04210 Apoptosis
    106600411 (jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106600411 (jun)
   04530 Tight junction
    106600411 (jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106600411 (jun)
   04621 NOD-like receptor signaling pathway
    106600411 (jun)
   04625 C-type lectin receptor signaling pathway
    106600411 (jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106600411 (jun)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106600411 (jun)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106600411 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 PspA_IM30 Jnk-SapK_ap_N
Other DBs
NCBI-GeneID: 106600411
NCBI-ProteinID: XP_014047204
UniProt: B5X2F5
LinkDB
Position
ssa03
AA seq 316 aa
MPTKMEATFYDESVNGQQGAVAGYHGVNPNSMKQSMTLNLNDPKMFKPHLRAKAIDILTS
PDVGLLKLASPELERLIIQSCNGLTTPTPTQFLCPKNITDEQEGFAEGFVRALAELHYQQ
HMPNGSCDSQTNASNDMASASTVSDSPISYSCTVRPEPPEYTNLGLFNRAVSSASAPTGD
RHSSASYTSVPSQTHIETQLPAQHPRLQPFKEEPQTVPEMSGDTPPMSPIDMESQERIKA
ERKRMRNRVAASKCRKRKLERISRLEDRVKNLKTQHTELVSSANVLRDELALLKQKVMDH
VNSGCQLILTQQLQAF
NT seq 951 nt   +upstreamnt  +downstreamnt
atgcccaccaagatggaagctacattctatgacgaatcggtaaatggtcagcaaggcgca
gtggctggatatcatggggttaacccgaatagtatgaagcagagtatgacactgaacctc
aacgaccctaaaatgtttaaacctcatctgcgggcgaaagctatcgatatactgacgtcc
cctgatgtgggattattaaaactggcctctccggaattggaaaggctcatcatccagtcc
tgcaatggtttgacgactccgaccccaactcagttcctctgtcccaagaacatcaccgac
gagcaagagggttttgctgagggtttcgtgagggcgctcgcggagcttcattatcaacag
catatgcctaatggcagttgtgactctcagacgaatgcttccaacgacatggcatccgca
tctactgtgtcggacagtcctatatcctacagctgcaccgtgcgccccgagccaccggaa
tacacaaacttgggccttttcaatcgggctgtcagctctgcgtcggcacctaccggcgac
agacactcctccgccagttacacgtccgtcccgtcccaaacccacatcgagacccagctg
ccagcccagcacccacggctacagccattcaaggaggagccccagacggtgcccgagatg
agcggcgatacccctccgatgtctcctatcgacatggagagccaggagaggataaaggcc
gagagaaagcgcatgaggaacagggtggccgcgtctaaatgccggaaaaggaagctggag
aggatctcgaggctcgaggacagggtcaaaaacctgaagacccaacacacagagttggtc
tcttctgccaacgtgctccgggacgaactggcactgctcaaacagaaggtcatggaccat
gttaacagcgggtgccaactcatattgacgcagcagctccaggcgttctga

KEGG   Salmo salar (Atlantic salmon): 106613963
Entry
106613963         CDS       T04363                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1-like
  KO
K04448  transcription factor AP-1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04137  Mitophagy - animal
sasa04210  Apoptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613963 (JUN)
   04012 ErbB signaling pathway
    106613963 (JUN)
   04310 Wnt signaling pathway
    106613963 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    106613963 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    106613963 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613963 (JUN)
   04530 Tight junction
    106613963 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613963 (JUN)
   04621 NOD-like receptor signaling pathway
    106613963 (JUN)
   04625 C-type lectin receptor signaling pathway
    106613963 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106613963 (JUN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106613963 (JUN)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    106613963 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 PspA_IM30 ZapB FlaC_arch DUF3450 Jnk-SapK_ap_N Paralemmin TEX13
Other DBs
NCBI-GeneID: 106613963
NCBI-ProteinID: XP_014072303
UniProt: B5X2N9
LinkDB
Position
ssa10
AA seq 327 aa
MSTKMETTFYDDSHNAFSQHQNAGYGYNPKALKHSMTLNLADPTITLKPHLQAKASDILT
SPDVQLLKLASPELERLIIQSSNGLITTTPTPTQFLCPRNVTDEQEGFAEGFVRALAELH
HQHVLPNAPGVPATSTGQTRINNSTTLPPVCSVAGSTVYNNVAMRSESPVYENLNTFTPA
VTTNSAPGYTTSVPAMSFPSAPPQLPIYGQQSHPHPRLTALKEEPQTVPEMLGETPPLSP
IDMENQERIKAERKRMRNRVAASKCRKRKLERISRLEDKVKNLKTQNSDLASTANMLREQ
VAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 984 nt   +upstreamnt  +downstreamnt
atgtctaccaagatggaaactactttctacgacgactcgcataacgctttctcccagcat
cagaacgcgggctacggatacaaccccaaagctctgaaacacagcatgacactgaacctg
gctgacccaaccatcacactcaaacctcacctccaagctaaagccagcgatatcctcacc
tctccggatgtgcagctcctcaaacttgcctccccagagttggagcgactcatcattcag
tccagcaacggcctgatcaccaccacacctaccccgacgcagttcctctgcccgaggaac
gtaactgatgagcaggagggctttgccgaggggttcgttagagctctggcggagctccat
catcaacacgtcttgcccaacgcacctggggtcccagccacctccaccgggcagacaaga
atcaacaactcgaccacactcccacctgtttgctccgtggctgggagcactgtttataac
aacgtagccatgcgctctgagtcacctgtctacgaaaacttgaacactttcaccccggct
gtcaccaccaactcagccccgggttacaccacctcagtgccggctatgagcttcccctct
gccccgcctcagctccccatctatgggcagcagtctcacccccaccccaggctcacagcc
ctgaaagaggagccccagacggtacctgagatgctcggggagacccctccactctctccc
attgacatggagaatcaggagaggatcaaagccgagaggaagcgcatgaggaaccgcgtc
gccgcttccaagtgcaggaagcggaagctagagcgcatctcccggctggaggacaaggtg
aagaacctgaagactcagaactccgacctggcttccacagccaacatgctgagggaacag
gtcgcccagctcaaacagaaggtgatgaaccatgtcaacagcggctgtcaactcatgctg
acgcagcagctccagaccttctga

DBGET integrated database retrieval system