KEGG   Salmo salar (Atlantic salmon): 106569074
Entry
106569074         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase RFWD2-like
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106569074
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106569074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106569074
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106569074
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106569074
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     106569074
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-C3HC4_4 WD40_like zf-rbx1 zf-RING_10 zf_C2H2_10 Prok-RING_4 DZR zf-RING_4
Other DBs
NCBI-GeneID: 106569074
NCBI-ProteinID: XP_013995516
UniProt: A0A1S3LXD4
LinkDB
Position
ssa14
AA seq 715 aa
MSSNRQQQTGGGAGPGPGSSSSTGGTTNANGATSVTLGGNDSANVNNSPNVVPSRTLAAA
GEGLLVPGVAVQSPRSLAPLSRSSSSSSGTSRKRPLHQAPLYNGLLNSYEDKSNDFVCPI
CFEMIEEAHMTKCGHSFCYKCIRQSLEDSNRCPKCNYVIDNVDQLYPNFLVNELILKQKQ
RSDEKRLKMDHPNGSRWQVFQDVLGTDQENLDLANVNLMLGLLVQKKKQLEAESQAAQRQ
ILMEFLKEARRNKREQLEQLQKELNFLEEDIKRVEEMSGLYLPVSDMDRNLDSTVPNFEA
PSPAPSSLIDSTEYVSQPPGFGGTSQGKRQTWYNSTLASRRKRLTAHFEDLEQCYFSDRM
TRITDDTRNLNQLDDFMECLSKFTRFNSVRPLATLSYASDLYNGSSIVSSIEFDRDGDYF
AIAGVTKKIKVFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVI
LWDGFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKA
NVCCVKFSPTSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSA
STDSQLKLWNVNKPHCLRSFKGHINEKNFVGLASNGDYVACGSENNSLYLYYKGLSKTLL
TFKFDTVKSVLDKDKKEDDTNEFVSAVCWRAMPDGDSNVLIAANSQGTIKVLELV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtcaagcaaccgtcaacagcaaactggcggtggagcaggtcctgggcctggaagtagc
agcagtaccggtggtacaaccaatgctaacggtgctaccagcgtaacgttaggcggcaat
gatagtgcgaatgtgaacaattctccaaatgttgtgccctcgcggactctggcagcagct
ggcgaggggttgcttgtacctggagtggctgtacagtctccaagaagcttagccccacta
agcagatccagttcatcctcctctggcaccagcagaaaacgtcctctccaccaagcacct
ctctacaatggtctcttgaattcctacgaagataaaagcaacgattttgtgtgcccgatc
tgttttgaaatgattgaggaggcacatatgacaaaatgtggacacagtttctgctacaag
tgcattcggcagagtttggaggacagcaataggtgcccaaaatgtaactacgtcattgac
aatgtggatcagctctatccaaactttcttgtgaatgaacttattctcaaacaaaaacag
agatccgatgaaaaacggctgaagatggaccatccgaatgggtcaagatggcaagtgttc
caagacgttctgggcacagaccaagagaacctagatcttgctaatgtcaacttgatgctg
ggactccttgtacagaaaaagaaacagctggaagcggaatcacaagctgctcaacgtcag
attttaatggaattcctcaaagaagcaagaagaaataaaagagagcaactggaacagttg
cagaaggagctaaactttttggaggaggatatcaagcgtgttgaggaaatgagtggactg
tacttgccagtgagtgacatggatcgtaacttggacagcactgtacctaatttcgaggct
ccctcacctgctcccagtagtcttatagattctacagagtatgtgagtcaacctccaggt
tttggtggaacttcacaggggaagagacaaacatggtacaacagcactctggcttctcgg
agaaagaggctcacagcacactttgaagatctggagcaatgctacttctctgaccggatg
acgcggataacagatgacaccaggaacttaaatcaactggatgatttcatggagtgtctc
tcaaagttcacacgcttcaactctgtacggccgttggcgaccctgtcttatgctagtgat
ctctacaacggctccagtattgtctctagtattgaatttgaccgtgacggcgattacttt
gccatcgccggcgtcaccaagaaaatcaaggtgtttgaatatggaactgtgatccaggat
gctgtggacattcattaccctgtcaatgaaatgacgtgcaactccaaaatcagctgtatc
agctggagcagctaccacaagaatctgttggctagcagcgactacgagggaacagtcatc
ctgtgggatggtttcactggccaaaggtcaaaggtctatcaggagcatgagaaaaggtgt
tggagtgtcgatttcaacctcatggatcccaagcttctagcctctggttctgatgatgca
aaagtgaagttatggtctaccaaccttgacaattcagtcgccagcatcgaggccaaagca
aatgtgtgctgtgtaaagttcagtccaacgtcgaggtatcatcttgcttttggttgtgca
gaccattgtgtccactactacgacctccgcaacactaaacagcccatcatggtgttcaaa
ggccacaggaaagctgtgtcctacgctaagtttgtcaacggagaggaaattgtatctgcc
tcaacagacagccagctaaagctgtggaatgtaaacaagccccactgcttgcgctcattc
aagggccacatcaatgagaagaactttgttggccttgcctccaatggagactatgttgcg
tgtggaagtgagaacaactctctgtatctatactacaaaggcctgtccaagacactgctg
acatttaagtttgacactgtgaagagtgtgctggataaagacaagaaggaagatgacacc
aatgagtttgtcagcgccgtatgctggagagctatgcctgacggggactccaatgtgctg
attgctgcaaacagtcaaggaacaatcaaggtacttgaacttgtttga

KEGG   Salmo salar (Atlantic salmon): 106599409
Entry
106599409         CDS       T04363                                 

Gene name
rfwd2
Definition
(RefSeq) ring finger and WD repeat domain 2
  KO
K10143  E3 ubiquitin-protein ligase RFWD2 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106599409 (rfwd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106599409 (rfwd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106599409 (rfwd2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106599409 (rfwd2)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    106599409 (rfwd2)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     106599409 (rfwd2)
SSDB
Motif
Pfam: WD40 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-C3HC4_4 WD40_like zf-RING_10 zf-rbx1 zf_C2H2_10 Prok-RING_4 UvrD-helicase DZR zf-RING_4
Other DBs
NCBI-GeneID: 106599409
NCBI-ProteinID: XP_014046095
UniProt: A0A1S3R158
LinkDB
Position
ssa03
AA seq 712 aa
MSSNRQQQTGGGAGPGTSSSTTGGTTNANGATSVGGNVSANVNNSSNVVPSRTLATTGDG
LLVPAAAVQSPISLATLSRPSSSSSGTSRKRPLHQAPLYNGLLNSYEDKSNDFVCPICFE
MIEEAHMTKCGHSFCYKCIRQSLEDSNRCPKCNYIIDNVDQLYPNFLVNELILKQKQRSD
EKRLKMDHPNGSRWQVFQDVLGTDQENLDLANVNLMLELLVQKKKQLEAESQAAQRQILM
EFLKEARRNKREQLEQLQKELNFLEEDIKRVEEMSGLYSPMSDMDRNLDSTVPNFEAPSP
APSSLIDSTEYVSQPPGFGGTSQGKRQTWYNSTLASRRKRLTAHFEDLEQCYFSNRMTRL
TDDSRNLNQLDDFMECLSKFTRYNSVRPLATLSYASDLYNGSSIVSSIEFDRDCDYFAIA
GVTKKIKVFEYGTVIQDAVDIHYPVNEMTCNSKISCISWSSYHKNLLASSDYEGTVILWD
GFTGQRSKVYQEHEKRCWSVDFNLMDPKLLASGSDDAKVKLWSTNLDNSVASIEAKANVC
CVKFSPTSRYHLAFGCADHCVHYYDLRNTKQPIMVFKGHRKAVSYAKFVNGEEIVSASTD
SQLKLWNVNKPHCLRSFKGHINEKNFVGLASNGDYVACGSENNSLYLYYKGLSKTLLTFK
FDTVKSVLDKDKKEDDTNEFVSAVCWRAMPDGESNVLIAANSQGTIKVLELV
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgtcaagcaaccgtcaacagcaaactggcggtggagcggggcctgggacaagtagcagc
actaccggtggcactaccaatgctaacggtgccaccagcgtaggcggtaacgtcagtgcg
aatgtgaacaattcttcaaatgttgtgccctcacggactctggctacaactggcgatgga
ttgctcgtacctgcagcggctgttcagtctccaataagcttagccacacttagcagaccc
agttcatcctcttctggcacaagcagaaaacgtcctctccaccaagcacctctctacaat
ggtctcttgaattcctacgaagataaaagcaacgattttgtgtgcccgatctgttttgaa
atgattgaggaggcacacatgacaaaatgtggacacagtttctgctacaagtgcattcgc
cagagtttggaggacagcaataggtgcccaaaatgtaactacatcattgacaacgtggat
cagctctatccaaactttcttgtcaatgaacttattctcaaacaaaaacagagatcagat
gaaaaacggctgaagatggaccatccaaatgggtcaagatggcaagtgtttcaagacgtc
ttgggcacagaccaagaaaacctagatcttgctaatgtcaacttgatgctggaactcctt
gtacagaaaaagaaacagctggaagcggaatcacaagctgctcaacgtcagatcttaatg
gaattcctcaaagaagcaagaagaaataaaagagagcaactggagcagttgcagaaggag
ctaaactttttggaggaggatatcaagcgtgttgaggaaatgagtggactgtactcacca
atgagtgacatggatcgtaacttggacagcacggtgcccaatttcgaggctccctcacct
gcacccagtagtcttatcgattcgacagagtatgtgagtcaaccaccaggttttggtgga
acttcccagggtaagagacaaacgtggtacaacagtactctggcttcacgcagaaagagg
ctcacagcgcactttgaagatctggagcaatgctacttctctaaccggatgacccgatta
acagatgacagcaggaacctaaatcaactggatgatttcatggagtgtctctcaaagttc
acacggtacaactctgtgcggccgttggcgaccctgtcttatgctagtgatctctacaac
ggctccagtattgtctctagcattgaatttgatcgtgactgtgattactttgccatcgct
ggcgtcaccaagaaaatcaaggtgtttgagtatggaacggtgatccaggatgctgtggac
attcattaccctgtcaatgaaatgacgtgcaactccaaaatcagctgtatcagctggagc
agctaccacaagaatctgttggctagcagcgactacgagggaacagtcatcctgtgggat
ggtttcactggccaaaggtcaaaggtctatcaggagcatgagaaaagatgttggagtgtc
gatttcaacctcatggatcccaagcttctagcctctggttctgatgatgcgaaagtgaag
ttatggtctaccaaccttgacaattcagtcgccagcatcgaggccaaagcaaatgtgtgc
tgtgtaaagttcagtccgacatcgaggtatcaccttgcttttggatgtgcagaccactgt
gtccactactacgacctccgcaacactaaacagcccatcatggtgtttaaaggccacagg
aaagctgtgtcctatgctaagtttgtcaacggagaggaaattgtatctgcctcaacagac
agccagctaaagctgtggaatgtaaacaagccccactgcttgcgctcattcaagggccac
attaatgagaagaactttgttggccttgcctccaatggagactatgttgcgtgtggaagt
gagaacaactcactttatctctactacaaggggctgtccaagacactgctgacattcaag
tttgacactgtgaagagtgtgttggataaagacaagaaagaggatgacaccaacgagttt
gtcagcgccgtatgctggagagctatgcctgacggggagtccaatgtgctgattgctgca
aacagtcaaggaacaatcaaggtacttgagcttgtttaa

DBGET integrated database retrieval system