KEGG   Salmo salar (Atlantic salmon): 106569083
Entry
106569083         CDS       T04363                                 

Definition
(RefSeq) protein patched homolog 1
  KO
K11101  patched 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106569083
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 106569083
NCBI-ProteinID: XP_013995546
UniProt: A0A1S3LXG1
LinkDB
Position
ssa14
AA seq 1454 aa
MASDPRVPGAGVFGDLPPSYTRSPPQVNSDLLRRPSYCHAAFALKQISKGKAVGQKAPLW
IRARFQALLFSLGCHIQRHCGKVLFIGLLVFGALSVGLRVAAIETDIEQLWVEAGSRVSR
ELRYTKEKQGEESVFTSQMLIQTPKQEGTNILTQDALLLHLEAALSASKVQVSLFGKSWD
LNKICYKSGVPIIENVMIERMIDKLFPCMIVTPLDCFWEGAKLQGGSAYLPGMPDIQWMN
LDPLKLMEELSQFTSLEGFREMLDKAQVGHAYMNRPCLDPNDSDCPLSAPNKDLRESPDI
AGQLQGGCHGFSKKFMHWQEELILGGRVKDTQNALQSAEALQTMFLLMSPKQLYEHFKDD
YEIHDINWNEDKATAILESWQRKFVEVAHGSIPQNSTSEIHAFSTTTLNDIMKSFSDVSV
IRVAGGYLLMLAYACATMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAAT
TQVLPFLALGIGVDDMFLLAHSFTETGINIPFKERTGDCLRRTGTSVALTSINNMIAFFM
AALVPIPALRAFSLQAAIIVVFNFAMVLLIFPAILSLDLHRREVKRLDILCCFYSPCSSR
VIQIQPQEFSDANDNTTHSHAPGAQTTTTYTGSTITTSTQITTTVQAFTQCDAAGQHIVT
ILPPTSQISTSPPSVVVATSPAHPSPTDPYGSQLFTPSSSTRDLLAQMDESKEARECVPL
PFFRWNLSSFARDKYAPLLLKPESKVVVVVLFVALLGLSLYGTTMVHDGLYLTDIVPRDT
KEYDFINAQFKYFSFYNMYLVTMDGFDYPRSQHLLIQLHNSFTSVKYVVRDSDQQLPRMW
LHYFQDWLRGLQAAFDADWEAGRITWDNYRNGTEDGVLAYKLLIQTGSKKDPFNYNQLTS
RRLVDDDGLIHPDVFYIYLTVWVSNDPLGYAASQGNFYPHPREWIHDKYDTTGENLRIPA
AEPLEFAQFPFYLNGLRQASDFIEGIESVRTICEEFTRKGVLNYPNGYPFLFWEQYIGLR
HWFLLAVSVVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSAIPVVI
LIASVGIGVEFTVHIALAFLTAVGNRNRRSAVALEHMFAPVIDGAISTLLGVLMLAGSEF
DFILRYFFAVLAILTVLGILNGLVLLPVLLSLMGPPPEVTPSDNGSCLSPEPLSPPMTHH
GYYAGHGPLSPRQQAFSESSESECYSETTTTSGIGEEYKYCDRSPYITPPTSHILLEASK
NPSFPKLTVVKPFKGNQSVTLQKELLNESSPNAVNSVSSQLKQWDNKHDCNSDQGPRRQH
LPSDRTQGPGRTNHCGPRSQTHKGPHQNRTKMPAYNGGTVPSSAVTTMVTATASVTVAVH
PSLPGAYQGYMHEGYEDSESDCFEDTKRTSQSCGKAPQSSKRESLELQDLESIQNHYQAN
QAQGGPWIQAAKDC
NT seq 4365 nt   +upstreamnt  +downstreamnt
atggcctcggatcccagagtcccaggggccggtgtttttggagatttacccccaagttat
acgcgttctccgccgcaagtaaactcagatcttctccggagacccagttactgccacgct
gctttcgcattaaaacagatttctaaggggaaggctgtgggtcagaaagccccgttgtgg
attcgggcgcggttccaggctcttctcttttctttgggctgtcacatccagcgacattgt
ggaaaagtccttttcattggactgcttgtgttcggtgccttgtctgtgggtttgcgggtt
gctgccattgagacggacattgagcaactctgggtggaagccggtagccgagtgagtcgg
gagctgcgctacaccaaggagaagcagggagaggagtctgtgttcacgtcgcagatgctc
atacaaacccccaaacaggaaggaactaacattctgacccaggatgctttgctgcttcac
ctggaggcagcgctctcggccagcaaggtccaagtgtctctgtttgggaaatcatgggat
cttaataaaatctgctacaaatctggagtccctatcatagaaaatgtcatgattgaaagg
atgattgacaagctgttcccctgtatgattgttaccccactggactgtttctgggaaggt
gcaaagctccagggggggtcagcatacttaccggggatgccggacatccagtggatgaac
ctggaccctctgaagctgatggaggagctcagccagttcaccagtctggagggcttcagg
gagatgctggacaaggcccaggtgggccacgcctacatgaaccgcccctgcctggacccc
aatgactccgactgccccctcagcgcacctaacaaggacctgagagagagtcctgacatt
gctgggcagctccaaggcggttgccacggcttctccaaaaagttcatgcactggcaggag
gagctgatcctgggcggtcgggtcaaggacacccagaatgctttgcagagtgcggaggcc
ctccagaccatgtttctcctgatgagccccaagcagctctacgaacactttaaggacgac
tatgagatccatgacatcaactggaacgaggacaaggccaccgccatcctggagtcctgg
cagaggaagtttgtggaggtggctcatggcagtatcccccagaactccacttcagagatc
cacgccttctccaccaccaccctcaacgacatcatgaagtccttttctgatgtcagtgtc
atccgggtggctggaggctacctgctcatgctggcctacgcctgtgcgaccatgctccgt
tgggactgtgccaagtcccagggggccgtggggctggctggcgtgctcctggtggctctg
tctgtggcagctggcctggggctgtgctctctgctgggcctgtcctttaacgctgccacc
acacaggttctccccttcctggctctggggatcggtgtggatgacatgttccttctggcc
cactccttcactgaaactggcatcaacatcccctttaaggagaggacgggggactgcctg
aggaggactggcaccagcgtggcgctcacctccatcaacaacatgatcgccttcttcatg
gcagccctggtccccatcccagcattgcgcgccttctctctgcaggcggccattattgtg
gtgttcaacttcgccatggtgcttcttatcttcccggccatcctgagtttggacctgcac
cgtcgggaggtcaaacgtctggacatcctgtgttgcttctacagcccctgctcctcccgg
gtcatccagatccaaccccaggagttctccgatgccaacgacaacaccacccatagccac
gcgcctggcgcccagactacaacgacctacacaggctccaccatcaccaccagcacccag
atcaccaccaccgtccaggccttcacccagtgtgacgctgcgggccagcacatagtcacc
atcctgccccccacctcccagatctccaccagccctccatctgtggtggtggccacctcc
cccgctcacccttcccccaccgacccctacggctcccagctcttcaccccctccagctcc
acccgggacctcctggcccagatggacgagtccaaggaggccagggagtgtgttcctctc
cccttcttccgctggaacctgtcaagcttcgcccgggacaagtacgctcctctcctcctg
aagccagagagcaaggtggtggtcgtggtcctcttcgtggctctgctggggctcagcctg
tacggaaccaccatggtccatgacggactctacctgaccgacattgtgccccgcgacacc
aaggagtacgacttcatcaacgcccagttcaaatacttctctttctacaacatgtacctg
gtgaccatggacggctttgactacccccgctcccagcatctccttatccagctgcacaac
tccttcacctcggtcaagtacgtggtgagggacagtgaccagcagctaccccggatgtgg
ctgcactattttcaggactggctaagaggactgcaggctgcctttgatgcagactgggag
gcaggcaggatcacctgggataactaccgtaacggcaccgaggatggtgttctggcctac
aagctgctcatccagaccggctccaagaaggaccccttcaactacaaccagctgacttcg
cgtcgtctggtggatgacgacggtctaattcacccagacgtcttctatatctacctgact
gtgtgggtgagcaacgaccctctgggctatgctgcctctcaggggaacttctaccctcac
ccccgtgagtggatccatgacaagtacgacaccaccggagagaacctgcgcatccctgcc
gcagagcccctggagtttgcccagttccccttctacctgaacggcctgaggcaggcatcc
gacttcatcgagggtattgagagtgtgcgcaccatctgcgaggagttcacccgtaaaggc
gtgctcaactaccccaacgggtaccccttcctgttctgggagcagtacatcggcctgcga
cactggttcctcctggcggtcagcgtggtgctagcctgcaccttcctggtctgtgccatc
ctcctgctcaacccctggaccgctggcatcattgtcttcatcctggctatgatgacggtg
gagctcttcggtatcatgggcctgatcggcatcaaactcagtgccatcccagtggtcatc
ctcatcgcctccgtaggcatcggcgtcgaattcaccgtccatatcgcactggcctttctg
acggccgtagggaataggaacaggcgttctgcggtggccctggagcacatgtttgcccct
gtgattgacggggccatctctactttgctgggggtcctaatgctggctggctccgagttt
gacttcatcctgaggtacttctttgcggtgctggctatcctgaccgtgctggggatcctg
aatggactggtgctgctacccgtgctgctctccctcatgggcccacccccggaggtcacc
ccgtccgataatggcagctgcctgtcgccggagcccctctcccctcccatgacccaccac
ggctactacgcgggacacggcccactcagcccgcgacaacaggccttctcagagtcctct
gagtctgagtgctactctgagacgactaccacgtcagggataggggaggagtacaagtac
tgtgaccgcagtccttacatcacccctcctacctcccacatactgctggaggccagcaag
aaccccagcttccccaagctcacggtggtgaaaccgttcaaagggaaccaatctgtaact
cttcagaaagaactcttaaatgaatcttctccgaatgcggttaactcggtcagctctcaa
ctcaagcagtgggataacaaacatgattgcaattctgaccagggacccaggaggcaacat
ttacccagtgacaggacccaaggtcctgggaggactaatcactgtggtcccaggtctcag
acacacaaagggcctcatcagaacaggactaagatgccggcctataatggcggtaccgtg
cccagtagtgctgttactaccatggttacggccacggcctcggtgactgtggcggtgcac
cccagcttgccgggggcctaccagggttacatgcatgagggttacgaggacagtgaatca
gactgttttgaggacactaagaggacttcacaatcttgtgggaaagctccccaatcttcc
aagcgtgaatccttggagcttcaagacctggaatctatacagaaccactatcaggcaaac
caggcacaaggtggcccatggatccaggcagccaaagattgctag

KEGG   Salmo salar (Atlantic salmon): 106580561
Entry
106580561         CDS       T04363                                 

Definition
(RefSeq) protein patched homolog 1-like
  KO
K06225  patched 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106580561
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 106580561
NCBI-ProteinID: XP_014017225
UniProt: A0A1S3NPQ5
LinkDB
Position
ssa20
AA seq 1174 aa
LSLSASLSLSLSPHPLSPSLSPQAVKQSVAANSSQKVLTFTTTTLEDILKSFSDVSIIRV
ASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGISFNAATTQV
LPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSISNVTAFFMA
ALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIFCCFYSPCANRV
IQIEPQVHVDGADSSRYSPPRPSYHTTPPTYCSSPPSYSSHCFSQQTQITMQSTVQLRTE
YDPRTQAFYTTAEPRSQISVQPFTPTPVATGPANNPNTSHASHASHASHGNNNHHSNHLS
QSGSSSGHVNLNNNNGSRGSGSVLSPPQSSSGVPTVSPQVGEGVCVSGESASSTRDLLSQ
FGGASLGLHCLEPHCSRWTLASFAEKHYAPFLLQPTTKVVVILLFLALLVVSLYGTTRVR
DGLELTDIVPRETSEYDFIGAQFKFFSFYNMYVVTQRAEYSQAQPLLYQLHHSFNTVRYV
LREDDGQLPRMWLHYFRDWLQALQEAFDQDWEAGWITQSSYRNGSDDGVLAYKLLVQTGR
RERPISVNQLTRQRLVDADGIINPVAFYIYLTAWVSNDPVAYAASQANIRPHPPEWLHDR
TDSMLETRLSIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICSNYSHQGLPSYPNG
YPFLFWEQYVGLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVELFGMMG
LIGIKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDRNRRAVLALEHMFAPVLDGAFS
TLLGVLMLAGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSYFGPYPEVTPVDGRSQ
LPTPSPESPPHVVHFSVHPCHTTSGTGTGTGSDSSDSEYSSNTTASGISQEPQQYNLPTT
RGRVGRAEEVRRGAVPRRTSRQGNATAHSLSSSVLPESDAHPGASRRFSKRDLQSLPPAR
PRMDAFETATEAGGHYGSGGHFVSGGNRERSARHRSRPSHKPRPNHHQPHHSNPAPTYCQ
PITTVTASASVTIAVHSASPPTQSPTSSYPGHTAADSYHTARGAEPEPAFQHPHVPLEVH
TGCRGTKMDTKVEAMELQDVECEAAESDCDKRAS
NT seq 3525 nt   +upstreamnt  +downstreamnt
ctctctctctctgcctctctctctctctctctctctccccatcctctctctccctccctc
tctccccaggcggtaaagcagagtgtagcagccaactcgtctcagaaagtgttgacgttt
accaccaccactctggaagacatcctcaagtctttctctgatgtcagcatcatacgagtg
gccagcggctacctgctcatgttggcctatgcgtgtctgaccatgctacgctgggattgt
gctaagtctcagggagctgtcggactggctggtgtcctcttggtggcgctgtctgtggct
gcaggcctggggctctgctctctcctgggcatatctttcaatgctgccaccacacaggtg
cttccgttcctggcactaggtgtaggtgtggatgatgtgtttctcctggcccatgccttc
agtgagacaggacagaacaagaggatcccatttgaggaccgtacaggggaatgtttgaag
aggacaggggctagtgtagctctcacctccatcagtaacgtcactgctttcttcatggca
gctctcatccctatacctgccctacgagccttctctctgcaggctgcggtggtggtcgtg
tttaactttgccatggtgctgctcatcttccctgccatcctcagtatggacctgtatcgc
agagaggaccggcgttttgacattttctgctgcttctacagcccttgcgctaacagggtg
atccagatcgagccccaggtccacgtggacggagcggacagcagtcgctacagcccccct
cgcccttcctaccacaccacccctcccacatactgcagctcacccccgtcctacagcagc
cattgtttctcccagcagactcagatcaccatgcagtctactgtccagctgaggacagag
tacgaccccaggactcaggccttttacactacggccgaacccagatcccagatctccgta
caacccttcacaccgacgcctgtcgccaccggccccgccaacaaccccaacaccagtcat
gctagtcacgctagtcacgccagtcacggaaacaacaaccaccacagcaaccatctcagc
cagagtgggagtagcagtggtcacgtcaacctcaacaacaacaacggtagccgtggttca
ggctcggtcctttctcctccccagtcgtcctctggcgtccccactgtctccccccaagtg
ggggagggggtgtgtgtgtcgggggagagtgccagctccaccagggatctgctgtcccag
tttggaggggcctctctggggctgcactgtctggagccccattgctcccggtggaccttg
gcctcctttgccgagaagcactacgcccccttcctactgcagcccaccaccaaggtagtg
gtcatcctgttgttcctggccctgctggtggtcagtctgtacgggaccacacgggtgcgg
gacgggctggagctgaccgacatcgttcccagggagaccagcgagtacgacttcatcggg
gcccagttcaagttcttctctttctacaacatgtacgtggtgacccagcgggcggagtac
tcccaggcccagcccctgctctaccagctgcaccacagcttcaacactgtccgctatgta
ctgagagaggacgacggacagctaccacgcatgtggctccactacttcagggactggctg
caagctctgcaggaagcatttgaccaggactgggaagcaggttggatcacacagagcagc
tacaggaacggttcagacgacggggtcctggcctacaaactactggtacagaccggacgc
agggaaaggcccatcagcgttaaccagctgactaggcagcgcttggtggatgcggatggc
atcatcaacccggtggcattttacatctacctgactgcgtgggtcagcaacgacccggtg
gcgtacgcagcctcacaggccaacatacggccacaccccccagagtggctccacgaccgc
acagactccatgctcgagacacgcctcagcattcctgctgccgagcccatcgagtacgca
cagtttccattctacctcaacgggctccgcgagaccccccagtttgtggaggccatcgag
tcggtgcgagccatctgcagtaactacagccaccagggcctacccagctaccccaacggc
taccccttcctcttctgggagcagtacgtaggcctcagacactggctgctgctctccatc
agcgtggtgctagcctgcaccttccttgtctgtgccctctttctgctcaacccctggact
gccggcatcattgtcctggtcctgtctctgatgaccgtggagctgtttggtatgatgggg
ctgatagggatcaagctcagtgctgttcctgtggtcatcctcatcgcctctgtcggcata
ggagtagagttcactgtacatgttgctctagcgttcctcacagcgataggggaccgtaac
aggcgggcagtgctggcgttagaacacatgtttgctcctgtgttggacggagccttctct
actctactaggagtcctcatgctagcaggctctgagtttgacttcatcgtcaggtatttc
tttgctgtgctggccatcctgaccattctgggggtgctgaatggtttggtccttctccct
gtgttgctgtcttactttggcccctatccagaggtgactcctgttgatgggcgtagccag
ttacccaccccgtcaccagagtcccctcctcacgtggtccacttctccgtccacccctgc
cacaccacctcagggacggggacaggtacaggctctgactcgtcagactctgagtacagc
tccaacaccacggcatcaggcatcagccaggagccccagcagtacaacctccccaccact
agaggcagagttgggagagcagaggaggtgcgacgaggagcagtgccaagacggacatct
agacaaggaaacgccacagcccactctttgtcttcttcggtcctgccggagtcggatgcc
caccctggtgcatcccgtcgcttcagcaagagggacctacagtcgctgcccccagcccgc
ccgcgcatggacgcttttgaaactgctactgaagctggaggccattacggctccgggggc
cattttgtctcgggaggcaaccgagaacgttctgcaaggcacagatctcgtccatcccac
aaaccccggcccaatcaccaccaacctcaccactctaaccctgcccctacttactgccag
cccatcaccacagtaacggcctctgcatcggttaccatcgccgtccactctgcctctccc
cccactcagagccccacctcctcttacccaggacacactgcagcggacagttaccacaca
gcaaggggcgcagagcctgagcctgccttccagcacccccatgtgccactggaggtccat
acgggttgcagaggaaccaagatggacaccaaggtggaggccatggagctccaggatgtg
gagtgtgaggcagctgagagcgactgtgataagagggcaagctga

KEGG   Salmo salar (Atlantic salmon): 106585152
Entry
106585152         CDS       T04363                                 

Gene name
ptch1
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106585152 (ptch1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 106585152
NCBI-ProteinID: XP_014026517
UniProt: A0A1S3PFX8
LinkDB
Position
ssa24
AA seq 1544 aa
MASAANASSEQENRDPDRPRITRRNRGNYRTTAPDLEYLQRPSYCDAAFALEQISEGKAT
GRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLRAANLETDVEKLWVE
VGGRVNQELKYTRQKMGEEAMFSPQLMIQTPRQEGANVLTVEALQQHLDSAIRASRVHVY
LFNRQWKLEHLCYKSGELVTEAHFMDQIIEKLHPCLIITPLDCFWEGAKLQSGMVYLPGK
PPLQWTNFDPKEFLTELRTLKFQVDSWEEMLEKADVGHGYMDRPCLNPQDPDCPLTAPNK
NTTKPFDVARVLTGGCHGLSRKYMHWQEELIVGGTTKNGTGPLLSAQALQTMFQLMTPKQ
MFEHLKGYEEVSHINWNQDKAAAILEAWQRKYSEAVQQSVAANSSQKVLSFTTTTLEDIL
KSFSDVSVIRVASGYLLMLAYACLTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLL
GISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALT
SISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRFDIF
CCFYSPCANRVIQIEPQAYLDGADGSHYSPPPTSFRTPPPSYSSHGFSQQTQITMQSTVQ
LRTEYDPRTQAFYTTAEPRSQISVQPFTPAATGPASNPNASHGVHGNNNHHSNHHSRSGS
SSSHGNLNNNNGSRGSGSVPFPPPPASSGVPPVSPQAGEGVCVTGESASSTRDLLSQFGE
ASLGLRCLEPPCSRWTLASFAEKHYAPFLLQPTTKVVVILLFLVLLGVSLYGTTRVRDGL
ELTDIVPRETSEYDFIGAQFKFFSFYNMYVVTQRAEYSQAQPLLYQLHFRFNTIRYVLRE
DNGQLPLMWLHYFRDWLQGLQAAFDQDWEAGRITQSSYRNGSDDGVLAYKLLVQTGRRDK
PINFNQLTRQRLVDADGIINPGAFYIYLTAWVSNDPVAYAASQANIRPHPPEWLHDRTDS
MPETRLSIPAAEPIEYAQFPFYLNGLRETPQFVEAIESVRAICSNYSRQGLPSYPNGYPF
LFWEQYVGLRHWLLLSISVVLACTFLVCALFLLNPWTAGIIVLVLSLMTVELFGMMGLIG
IKLSAVPVVILIASVGIGVEFTVHVALAFLTAIGDRNRRAVLALEHMFAPVLDGAFSTLL
GVLMLAGSEFDFIVRYFFAVLAILTVLGVLNGLVLLPVLLSYFGPYPEVTPVDGRSRLPT
PSPEPPPHVVRFSVRPRHTTSGTGTGTGSDSSDSEYSSNTTGSGISQELQQYDLPATRGR
AGRTEDMQYGTQTSRGRAVRTEEVRLGAGPRRTARQGDATAYSVSSSVLPESGAHPGTSR
RFSKRDLQSLPPARPRMDAFEDATEAGGHYSSGGHFGSGGHRERSAGHRTRPSHNPRPNH
HQPHHPNPAPTYCQPITTVTASASVTVAVHSAPPPTQSPTSSYPGHTAANSYHTAGGAEP
VPTFQDPHVPLEVHISRRGTKMEAMELQDVECEAAESDCGKRAS
NT seq 4635 nt   +upstreamnt  +downstreamnt
atggcctcggctgctaatgcctcctccgagcaggaaaacagggaccccgatcggccgagg
ataacgcggaggaacagggggaactatcgcacaacagcgccggatttggagtatttgcag
cgaccaagttactgcgatgcagctttcgccttggagcaaatatccgaggggaaggcgact
ggaagaaaagcaccgctgtggctgagagcgaagtttcagagactcttgtttaagttgggc
tgttacatacaaaagaactgcggaaagtttttggttgtgggcctcttgatattcggagct
ttcgctgttggcttacgggcggcgaatctggaaaccgacgtggagaaactctgggtagaa
gtgggcggcagggtgaatcaggagctgaagtacacgcgtcagaagatgggcgaggaggcc
atgttcagtccccagctgatgatccagacgccgcgccaggagggcgctaatgtgctcact
gtggaggcgctacaacaacacctggattccgctatcagggccagccgagtgcacgtttac
ctctttaacagacaatggaaattggaacatttatgctacaaatcaggagaacttgttacc
gaagctcattttatggaccagattattgagaagctgcacccctgtctcatcatcacgccc
ctggactgtttctgggagggagccaagctccagtctggaatggtctacctccccggaaag
ccccctctgcagtggaccaactttgaccccaaggagttcctaacggagctgcggactctg
aagtttcaggtggacagctgggaggagatgctggagaaggctgacgtgggacacggctac
atggaccgaccctgtctcaacccccaagaccccgactgtcccctcactgctcccaacaag
aacaccaccaagccctttgacgtggctcgcgtcctgactggcggatgccatggcctctcc
aggaagtacatgcactggcaggaagagctgatcgtaggggggaccaccaagaatggcacc
ggaccactactcagtgcccaggcattacagaccatgttccagctgatgactcctaagcag
atgtttgagcacctgaagggctatgaggaggtgtcccatatcaactggaaccaagacaag
gccgcagccatactggaggcctggcagaggaaatactcggaggcggtacagcagagtgta
gccgccaactcgtctcagaaggttttgtcgtttaccaccaccactctggaagacatcctc
aagtctttctccgatgtcagcgtcatacgagtggccagcggctacctgctgatgttggcc
tatgcttgtctgaccatgctacgttgggactgtgctaagtctcagggagctgtaggactg
gccggtgtcctcttggtggcgctgtctgtggctgcaggcctggggctctgctctctgttg
ggaatatccttcaacgctgccaccacacaggtgcttccgttcctggcactaggtgtgggt
gtggatgacgtgtttctcctggcccacgccttcagtgagacgggacagaacaagaggatc
ccctttgaggaccgtacgggggagtgcttgaagaggacaggagcgagtgtagctctcacc
tcgatcagcaacgtcactgctttcttcatggcagctctcatccctatacctgccctacga
gccttctctctgcaggctgcggtggtggtggtgtttaactttgccatggtgctgctcatc
ttccctgccatcctcagtatggacctgtatcgcagagaggaccgccgctttgacatcttc
tgctgcttctacagcccgtgtgctaacagggtgatccagatcgagccccaggcttacctg
gacggagcagacggtagtcactacagcccccctcctacctccttccgcaccccccctccc
tcctacagcagccatggtttctcccagcagactcagatcaccatgcagtctaccgtccag
ctgaggacagagtacgaccccaggactcaggccttctacactacagccgaacccaggtcc
cagatctccgtacaaccgtttacacccgcagccaccggccccgccagcaaccccaacgcc
agtcacggtgttcatggcaacaacaaccaccatagcaaccatcacagccggagtgggagt
agcagtagtcacggcaacctgaacaacaacaacggtagccgtggttccggctcagtcccg
ttccctcctcccccggcctcctctggcgttccccctgtctccccccaggcgggggagggg
gtgtgtgtgacgggggagagtgccagctccaccagggatctgctgtctcagtttggagag
gcctctctggggctgcgctgtctggagcccccttgctcccgatggaccctggcctccttc
gcagagaaacactacgcccccttcctactgcagccaaccaccaaggtggtagtcatcctg
ctgttcctggtcctgctgggggtcagtctgtacgggaccacacgggtacgggacgggctg
gagctgaccgacatcgttcccagggagaccagcgagtacgacttcatcggggcccagttc
aagttcttctccttctacaacatgtacgtggtgacccagcgggcggagtactcccaggcg
cagcccctgctctaccagctgcacttccgcttcaacacgatccgctacgtactgagggag
gacaacggccagctgccactcatgtggctccactacttcagggactggctgcaaggtctg
caggcagcgtttgatcaggactgggaggcgggtcggatcacacagagcagctacaggaac
ggttcagacgacggggtcctggcctacaaattgctggtacagaccggacgcagggacaag
cccatcaacttcaaccagctgacgaggcagcgcttggtggatgcggatggcatcatcaac
ccgggggcgttttacatctacctgacggcgtgggtcagcaacgacccggtggcgtacgca
gcctcgcaggccaacatacggccacaccccccggagtggctccacgaccgcacagactcc
atgcccgagacacgcctcagcattcctgccgccgagcccatcgaatacgcacagttcccc
ttctacctcaacgggctccgcgagaccccccagtttgtggaggccatcgagtcggtgcgg
gccatctgcagtaactacagccgccagggcctgcccagctaccccaacggctaccccttc
ctcttctgggagcagtacgtaggcctcagacactggctgcttctctccatcagcgtggtg
ctagcctgcaccttcctcgtctgtgccctcttcctgctcaacccttggaccgccggtatc
atcgtgctggtcctgtctctgatgaccgtggagctgtttggtatgatggggctgataggg
atcaagctcagtgctgttcctgtggtcatcctcatcgcctctgtgggcatcggagtagag
tttactgtccatgtggctctggcattcctcacagcgataggggaccgtaacaggcgggca
gtgctggcgttagaacacatgtttgctccggttttggacggagccttttctactctacta
ggagtcctcatgctggcaggctccgagtttgacttcatcgtcaggtatttctttgctgtg
ctggccatcctgacagttctgggagtgctgaatggtttggtccttcttcctgtgttgctg
tcctacttcggcccctacccagaggtgacccctgtggatgggcgtagccggttacccacc
ccttccccggagcctcctcctcacgtggtacgcttctcagtccgcccacgccacaccacc
tccggcacgggcacaggaacgggctctgactcgtccgactctgagtacagctccaacacc
acgggatcaggcatcagccaggagctgcagcagtacgacctccctgccactaggggcaga
gctgggagaacagaggacatgcagtacggcacccagaccagcaggggcagagctgttaga
acagaggaggtgcgactaggagcagggccaagaaggacagctagacaaggagacgccacg
gcctactctgtgtcttcttcggtcctgccggagtcaggggcccaccctggtacatcccgt
cgcttcagcaaaagggacctacagtcgctgcccccagcacgcccgcgcatggacgctttt
gaggacgctaccgaggctggaggccattacagctccggaggccattttggctcgggcggc
cacagagaacgctccgcggggcacaggacccgtccatcccacaacccccggcccaatcac
caccaacctcaccaccctaaccccgcccctacttactgtcagccaatcaccacggtaacg
gcctctgcgtcggttaccgtcgccgtccactctgcccctccccccactcagagccccact
tcctcttacccaggacacactgcagcaaacagttaccacacagcaggcggcgcagagccg
gtgcctaccttccaggacccccatgtgccactggaggtccatatcagccgcagaggaacc
aagatggaggccatggagctccaggatgtggagtgtgaggcagctgagagcgactgtggc
aagagggcaagctga

KEGG   Salmo salar (Atlantic salmon): 106599390
Entry
106599390         CDS       T04363                                 

Definition
(RefSeq) protein patched homolog 1-like
  KO
K11101  patched 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106599390
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 106599390
NCBI-ProteinID: XP_014046075
UniProt: A0A1S3R138
LinkDB
Position
ssa03
AA seq 1462 aa
MASDPRVPGAGVFGDLPPNYMRSPPPVNSDLLRRPSYCHAAFALKQISKGKAVGQKAPLW
VRARFQALLFSLGCHIQRHCGKVLFIGLLVFSALSVGLRVAAIETDIEQLWVEAGSRVSR
ELRYTKEKQGEESVFTSQMLIQTPKQEGTNILTQGALLLHLEAALSASKVQVSLFGKSWD
LNKICYKSGVPIIENVMIERMIDKLFPCMIVTPLDCFWEGAKLQGGSAYLPGMPDIQWMN
LDPLKLMEELSQFTSLEGFREMLDKAQVGHAYMNRPCLDPNDPECPLSAPNKDLRESPDI
AGRLQGGCHGFSKKFMHWQEELILGGRVKDTQNALQSAEALQTMFLLMSPKQLYEHFKDD
YEIHDINWNEDKATAILESWQRKFVEVAHGSIPQNSTSEIHAFSTTTLNDIMKSFSDVSV
IRVAGGYLLMLAYACVTMLRWDCAKSQGAVGLAGVLLVALSVAAGLGLCSLLGLSFNAAT
TQVLPFLALGIGVDDMFLLAHSFTETGINIPFKERTGDCLRRTGTSVALTSINNMIAFFM
AALVPIPALRAFSLQAAIIVVFNFAMVLLIFPAILSLDLHRREDKRLDILCCFYSPCSSR
VIQIQPQEFSDANDNTTTTTTTHSHAPGTQTTTTYTGSTIITSTQITTTVQAFTQCDAAG
QHIVTILPPTSQISTSPPSVVVASSPVPPSPTDSYGSQLFSPSSSTRDLLAQMDESKEAR
ECVPLPFFRWNLSSFARDKYAPLLLKPESKVVVVVLFVALLGLSLYGTTMVHDGLYLTDI
VPRDTKEYDFINAQFKYFSFYNMYLVTMDGFDYARSQRLLIQLHNSFISVKYVVKDSDQQ
LPRMWLHYFQDWLRGLQAAFDADWESGRITWDNYRNGTEDGVLAYKLLIQTGSKKDPFNY
NQLTSRRLMNEEGLIHPEVFYIYLTVWVSNDPLGYAASQGNFYPQPREWIHDKYDTTGEN
LRIPAAEPLEFAQFPFYLNGLRQASDFIESIESVRAICEEFTRKGVLNYPNGYPFLFWEQ
YIGLRHWFLLAVSVVLACTFLVCAILLLNPWTAGIIVFILAMMTVELFGIMGLIGIKLSA
IPVVILIASVGIGVEFTVHIALAFLTAIGNRNRRSAVALEHMFAPVIDGAISTLLGVLML
AGSEFDFILRYFFAVLAILTVLGILNGLVLLPVLLSLMGPPPEVTPADNGSRLPTPLPEP
LPPPMTHHGYYGGHGPQGPRQQAFSESSDSEYYSETTTTSGIGEEYKYCDRSPYITPPTS
HILLEDSKNPSFPKLTVVKPFKEGPTVTAQKDLLNESSLNAVTSVSSQLTQWDNKHDYKS
DQGPRRQHLPSDRTQGPERTNHCGPRSQTNRGPHQNRTKMPAYNGGTAPSSAVTTMVTAT
ASVTVAVHPSLPGAYHGYMHEGYVDSESDCFEDTKRTSQSCGKATQSSKRESLEVEDLES
VQNQHQANQAQVGPRIQAAKDY
NT seq 4389 nt   +upstreamnt  +downstreamnt
atggcctcggatcccagagtcccaggggccggtgtttttggagatttacccccaaattat
atgcgttctccgccgccagtaaactcagatcttctccggagacccagctactgccacgct
gctttcgcattaaaacagatttctaaggggaaggctgtgggtcagaaagccccgttgtgg
gttcgggcgaggttccaggctcttctcttttctttgggctgtcacatccagcgacattgt
ggaaaagtccttttcattggactgcttgtgttcagtgccttgtctgtgggtttgcgggtc
gctgccattgagacggacattgagcaactatgggttgaagccggtagccgagtgagtcgg
gagctgcgctacaccaaggagaaacagggagaggagtctgtgttcacgtcacagatgctc
atacaaacccccaaacaggaagggaccaacattctgacacagggtgctttgctgcttcac
ctggaggcagcgctctcagccagcaaggtccaggtgtctctgtttggaaaatcatgggat
ctcaataaaatctgctacaaatctggtgtccctatcatagaaaatgtcatgattgaaagg
atgattgacaagctgttcccctgtatgattgttaccccactggactgtttttgggaaggt
gcaaagctccagggggggtcagcatacttaccggggatgcctgacatccagtggatgaac
ctggaccctctgaagctgatggaggagctcagccagttcaccagtctggagggcttcagg
gaaatgctggacaaggcccaggtgggtcacgcttacatgaaccgcccctgcctggacccc
aacgaccccgagtgccccctcagcgcccccaacaaggacctgagagagagtcctgacatt
gccgggcgtctccaaggtggttgccacggcttctccaaaaagttcatgcactggcaggag
gagcttattctgggcggccgggtcaaggacacccagaatgctttgcagagtgcggaggcc
ctccagaccatgtttctcctgatgagccccaagcagctctacgagcactttaaggacgac
tatgagatccatgacatcaactggaatgaggacaaggccaccgccatcctggagtcctgg
caaaggaagtttgtagaggtggctcatggcagtatcccccagaactccacttcagagatc
catgccttctccaccaccaccctcaacgacatcatgaagtccttctctgatgtcagtgtc
atccgggtggctggaggctacctgctcatgctggcttacgcctgtgtgaccatgctccgt
tgggactgtgccaagtcccagggggccgtggggctggctggcgtgctcctggtggctctg
tctgtggcagctggcctggggctgtgctctctgctgggcctgtcctttaacgctgccacc
acacaggttctccccttcctggctctggggatcggtgtggatgacatgttccttctggcc
cactccttcactgagactggcatcaacatcccctttaaggagaggacaggggactgcctg
aggaggactggcaccagtgtggcgctcacctccatcaacaacatgatcgccttcttcatg
gcagccctggtccccatcccagcactgcgtgccttctctctgcaggcggccattattgtg
gtgttcaacttcgccatggtgctcctcatcttcccggccattctgagtttggacctacac
cgtcgggaggacaagcgtctggacatcctgtgttgtttctacagcccctgctcctcccgg
gtcatccagatccaaccccaggagttctccgatgccaacgacaacaccaccaccaccacc
accacccacagccacgcgcctggcacccagactacaacaacctacacaggctccaccatc
attaccagcacccagatcaccaccaccgtccaggccttcacccagtgtgacgcggcaggc
cagcacatagtcaccatcctgccccccacctcccagatctccaccagccctccctctgtg
gtggtggcctcctcccctgttcccccctcccccaccgactcctacggctcccagctcttc
agcccatccagctccacccgggacctcctggcccagatggatgagtccaaggaggccagg
gagtgtgttccactccccttcttccgctggaacctatcaagcttcgcccgggacaagtac
gctcctctcctcctaaagccagagagcaaggtggtggtcgtggtcctctttgtggctctg
ctggggctcagcctgtacggaaccaccatggtccatgatggactctacctgaccgacatt
gtgccccgcgacaccaaggagtacgacttcatcaacgcccagttcaagtacttctctttc
tacaacatgtacctggtgaccatggacggctttgactacgcccgctcccagcgtctcctc
atccagctgcacaactccttcatctcggtcaagtatgtggtgaaggacagcgaccagcag
ctgccccggatgtggctgcactatttccaagactggctcagaggactgcaggctgccttc
gatgcagactgggaatcaggcagaatcacctgggataactaccgtaacggcactgaggat
ggtgttctggcctacaagctgctcatccagacaggctccaagaaggaccccttcaactac
aaccagctgacttctcgtcgtctgatgaatgaggagggtctgattcacccagaggtcttc
tatatctacctgactgtgtgggtgagcaatgaccctctgggctatgctgcctctcagggt
aacttctaccctcagcctcgcgagtggatccacgacaagtatgacaccaccggagagaat
ctgcgcatccctgccgcagagcccctggagtttgctcagttccctttctacctgaacggc
ctgaggcaggcgtccgacttcatcgagagcatcgagagcgtgcgcgccatctgcgaggag
ttcacccgtaaaggtgttctcaactaccccaacggttaccccttcctgttctgggagcag
tacatcggcttgcgacactggttcctcctggcggtcagcgtggtgctagcctgcaccttc
ctggtctgtgccatcctcctgctcaacccctggaccgctggcatcattgtcttcatcctg
gccatgatgacggtggagctgtttggtatcatgggcctgatcggcatcaagctcagtgcc
atcccagtggtcatcctcatcgcctctgtgggcatcggcgttgagttcactgtccatatc
gcactggcctttctgacggccataggcaataggaacaggcgttctgcggtggccctggag
cacatgtttgcccctgtgattgacggggccatctctactctgttaggggtcctcatgctg
gctggctccgagtttgacttcatcctgaggtacttctttgcggtgctggctattctgacc
gtgctggggatcctgaatggactggtgctgctgcccgtgctgctctccctcatgggccca
cccccggaggtcaccccggccgacaacggcagccgcctgcccaccccgttgccggagccc
ctcccccctcccatgacccaccacggctactacggaggacacggtccacagggcccacga
caacaggccttctcagagtcatcggactctgagtactactctgaaacgactaccacatca
ggaattggggaggagtataagtactgtgaccgcagtccttacatcacccctcctacctct
catatactactggaggacagcaagaaccccagcttccccaaactcacggtggtgaaaccg
ttcaaagagggcccgaccgtaaccgctcagaaagatctcttaaatgagtcttctctgaat
gcggtgacttcggtcagctctcaactcacgcagtgggataacaaacatgattacaaatct
gaccagggacccaggaggcaacatttacccagtgacaggacccagggtcctgagaggact
aatcactgtggtcccaggtctcagaccaacagagggcctcatcagaacaggactaagatg
ccggcctataatggcggtaccgcgcccagtagtgctgttactaccatggttacggccaca
gcctctgtgactgtggctgtgcaccccagcttgccgggggcctaccatgggtacatgcac
gagggctacgtggacagtgaatcagactgttttgaggacactaagaggacttcacaatct
tgtgggaaagctacccaatcttccaagcgtgaatccttggaggttgaagacctggaatct
gtacagaaccagcatcaggcgaaccaggcacaagttggcccacggatccaggcagccaaa
gattactag

DBGET integrated database retrieval system