KEGG   Salmo salar (Atlantic salmon): 106569189
Entry
106569189         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04621  NOD-like receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106569189
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106569189
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106569189
  09143 Cell growth and death
   04210 Apoptosis
    106569189
   04217 Necroptosis
    106569189
   04115 p53 signaling pathway
    106569189
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106569189
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106569189
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106569189
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106569189
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106569189
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106569189
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106569189
NCBI-ProteinID: XP_013995755
UniProt: A0A1S3LY06
LinkDB
Position
ssa14
AA seq 354 aa
MANDDNRCIVEKYICHKLLKRGYAWDFENAEDEEDADNNGSMISPPPGLARRCHGANNAR
PGSVPHLSKRLSQTDPHAAIHRVLREAGDELERLYQPDFAEMSHQLYLTSSMAERRFREV
IDELFRDGVNWGRIVAFFEFGGTICVECVNKEMTSQVDHIAGWMTEYLNGPLHSWIQENG
GWSLRNINPQLRPTVTPLPTPVKQRPLLSSMTDRGTPCSVRGRPSRLSLAWLHWGLQALP
SELTLHRSEGVPPPLSFFFFSLPLSLLSLFKGPLQDPQPACLQSFSPLSRKNLPLPHLKN
RHKSNNSRKWSHCPHRREYVMKVVPFNCNHKKFGLKRDEMKGGLVSFLFCLLEY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atggcaaacgacgacaaccgctgtatagtggaaaagtacatttgtcacaaactcttgaaa
aggggatatgcgtgggatttcgagaatgccgaggatgaggaagatgctgataataatggg
tcgatgatttctcctccgcctggtttggcacggcggtgccacggggccaataacgccaga
ccgggcagcgtcccccatctttccaaacggctctcccaaacggacccgcatgcagctatt
cacagagttttgcgtgaggccggggacgaactcgaacgactgtaccagcccgactttgcg
gagatgtcacaccaattgtatctcacgtcttctatggcagaaaggagattcagagaggtg
atagacgagctgttcagggacggggttaactggggacgaattgtcgccttcttcgagttc
gggggcacaatatgtgtggaatgcgtgaacaaggaaatgacgtcgcaggttgaccacatc
gccgggtggatgacggagtatctaaatggaccgctgcacagctggattcaagagaacggg
ggatggtcactgaggaacataaatccacagttaaggcctacagttactcctctcccgact
cccgtgaaacagaggcctttgttgagctctatgacagacagagggactccgtgttctgtt
cgtggccgtccatcaagactgtctttggcctggctgcactgggggctgcaagccttacca
tcggagcttaccttacacagaagtgaaggagtccccccccctctctctttctttttcttc
tccctcccgctctcactcctttctcttttcaaaggccccctccaagatccccaacctgcc
tgtcttcaaagcttctctcccctttctcgaaaaaacctccctcttcctcacttaaaaaac
agacacaaatcaaacaacagcaggaaatggagtcactgcccacacagaagagaatatgtc
atgaaagtcgtgccatttaactgtaatcacaaaaagtttggcttgaaaagagacgagatg
aagggagggttggtgtcgtttttgttctgcctgcttgagtactag

KEGG   Salmo salar (Atlantic salmon): 106579593
Entry
106579593         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04621  NOD-like receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106579593
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106579593
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106579593
  09143 Cell growth and death
   04210 Apoptosis
    106579593
   04217 Necroptosis
    106579593
   04115 p53 signaling pathway
    106579593
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106579593
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106579593
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106579593
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106579593
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106579593
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106579593
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 BH4 DUF4350
Other DBs
NCBI-GeneID: 106579593
NCBI-ProteinID: XP_014015121
UniProt: A0A1S3NIV8
LinkDB
Position
ssa19
AA seq 228 aa
MMANENPYNSRFIVEKYIHHKLLNMGFVWKFQAENDSPNNGFGDPSTPNSPEVFARRSQP
TAAGEDTDPPYQNRSPQPDPHARLHRVLRDAGGEIERMYQRDFAEMSGQLHFTPSTAQRR
FTAVIDELFSDGVNWGRIVAFFEFGGTMCVESVNREMTSQVDNIARWMMEYLNGPLQNWI
QENGGWDAFVEIYEQQRISHSWPYLKTVFGLAALGAAGVTIGALFTQK
NT seq 687 nt   +upstreamnt  +downstreamnt
atgatggcaaacgagaatccttacaacagtcgctttattgtcgaaaaatacatccatcac
aaactgttgaacatgggatttgtatggaaatttcaagcagaaaacgattctccaaataat
ggctttggggacccctctacacccaactcccccgaagtttttgcacggaggtcccagccc
accgccgcgggcgaggacaccgaccctccttaccaaaacaggagtccgcaacctgaccca
catgccaggctccacagggtcctgcgcgatgcgggtggcgagattgaaagaatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacacccagcacggcacagagaagg
tttaccgctgtaatagatgagctcttcagcgacggggtaaactggggtcggattgtggct
ttctttgagtttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgtcccag
gtagacaacatcgctcgttggatgatggagtacttgaacggacccctacagaactggatc
caggagaatggtggctgggacgcctttgtggagatctatgagcagcagaggatctctcac
tcctggccgtacctaaagacagtgttcggcctggccgccctgggagccgctggagtcacc
atcggagccttgttcacccagaagtga

KEGG   Salmo salar (Atlantic salmon): 106590353
Entry
106590353         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04621  NOD-like receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106590353
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106590353
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106590353
  09143 Cell growth and death
   04210 Apoptosis
    106590353
   04217 Necroptosis
    106590353
   04115 p53 signaling pathway
    106590353
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106590353
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106590353
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106590353
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106590353
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106590353
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106590353
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106590353
NCBI-ProteinID: XP_014036765
UniProt: A0A1S3Q9V5
LinkDB
Position
ssa29
AA seq 230 aa
MMANDNPYNSRFIVEKYIHHKLLKKGFVWEFNPENDSPNNGFGEPSPPNSPEVFARRSQP
SAEGVDTDSPLPNRIPQPDRHARLHRVLREAGDEIEIMYQRDFAEMSGQLHFTPSTAQRR
FTAVIEELFRDGVNWGRIVAFFEFGGTMCVESVNREMTTQVDNIAHWMTEYLNGPLQNWI
QENGDWDAFVEIYGQQRISVFHSWPYLKTVFGLAALGAAGVTIGALFIQK
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatggcgaacgataatccttataacagtcgctttattgttgaaaaatacatccatcac
aaactgttgaagaagggatttgtatgggaatttaatccagaaaatgattccccaaataat
ggctttggggagccctctccccctaactcccctgaagtttttgcacggaggtcccagccc
tccgctgaaggcgtggacactgactctccgctcccaaacaggatcccgcaaccggaccga
catgcccggctccatagggtgctgcgcgaggcgggggacgagattgaaataatgtatcag
cgggactttgcagagatgtcggggcagttgcattttacgcccagtacagcacagagaagg
tttactgctgtaatagaggagctcttccgcgacggtgtaaactggggtcggattgtggct
ttctttgagtttggagggacaatgtgcgtggagagcgtcaaccgggagatgacgacccag
gtagacaacattgcccattggatgacagagtacctgaacggacccctgcagaactggatc
caggagaatggtgactgggacgcctttgtggagatctatgggcagcagaggatctctgtc
ttccactcctggccctacctaaagacagtgttcggcctggccgccctgggtgcagccgga
gtcaccattggagcgttgttcatccagaagtga

KEGG   Salmo salar (Atlantic salmon): 106599248
Entry
106599248         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator Bcl-2-like
  KO
K02161  apoptosis regulator Bcl-2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
sasa04621  NOD-like receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106599248
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106599248
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106599248
  09143 Cell growth and death
   04210 Apoptosis
    106599248
   04217 Necroptosis
    106599248
   04115 p53 signaling pathway
    106599248
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106599248
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106599248
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106599248
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106599248
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106599248
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106599248
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3 DUF4350
Other DBs
NCBI-GeneID: 106599248
NCBI-ProteinID: XP_014045847
UniProt: A0A1S3R1W1
LinkDB
Position
ssa03
AA seq 226 aa
MANDDNRFIVEKYICHKLLKRGYAWDFEDAEEEEGAANNGSMISPRLGLARRCHGANNAG
PSSVPSLSKWLSQPDPHAAIHRVLREAGDELERLYQPDFAEMSHQLYLTSSTAERRFREV
IDELFRDGVNWGRIIAFFEFGGTICVECVNKEMTSQVDHIAVWMTEYLNGPLLSWIQENG
GWEAFVELYDRQRDSVFCSWPSIKTVFGLAALGAASLTIGAYLTQK
NT seq 681 nt   +upstreamnt  +downstreamnt
atggcaaacgacgacaaccgcttcatagtggaaaagtacatttgtcacaaactcttgaaa
cgaggatatgcgtgggatttcgaggatgccgaggaggaggaaggtgccgctaataatggg
tcgatgatttctcctcggctgggtttggcacggcggtgccacggggccaataacgccggc
ccgagcagcgtccctagtctttccaaatggctctcccaaccggacccgcatgcagctatt
cacagagttttgcgtgaggccggggatgaactcgaaagactgtaccagcccgacttcgca
gagatgtcacaccagctgtatctcacatcctccacggctgagaggagatttagagaggtg
atagacgagctgttcagggatggggttaactggggacggattatcgccttcttcgagttc
gggggcacaatatgcgtggaatgcgtgaacaaggagatgacgtcgcaggtggatcacatc
gcggtgtggatgacagagtatctaaatggaccactgctcagctggattcaggagaacggg
ggatgggaggcctttgttgagctctatgacagacagagggactctgtgttctgttcgtgg
ccatccatcaagaccgtcttcggcctggctgcactgggggccgcaagccttaccattgga
gcataccttacacagaagtga

DBGET integrated database retrieval system