KEGG   Salmo salar (Atlantic salmon): 106569218
Entry
106569218         CDS       T04363                                 

Definition
(RefSeq) cullin-1-like
  KO
K03347  cullin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04141  Protein processing in endoplasmic reticulum
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106569218
   04120 Ubiquitin mediated proteolysis
    106569218
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106569218
   04340 Hedgehog signaling pathway
    106569218
   04350 TGF-beta signaling pathway
    106569218
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106569218
   04114 Oocyte meiosis
    106569218
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106569218
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     106569218
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 106569218
NCBI-ProteinID: XP_013995833
UniProt: A0A1S3LY50
LinkDB
Position
ssa14
AA seq 777 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGPPPSKPSKKAPTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFY
TQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQV
TNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLSVYKEYFETQFLAD
TERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKH
LEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGEAA
LNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSP
ELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNS
ASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQV
LSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRY
TLQASTFQMAILLQYNAEDVYTVQQLADSTQIKIDILVQVLQILLKSKLLVLEDENANVD
EVEFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIM
KMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtcatccaatagaagccagaaccctcatgggctcaagcagattggcctggatcagatc
tgggatgacctgcgagcaggaatacagcaggtgtacaccagacagagcatggccaaatca
cgatatatggaactgtacacacatgtttataactactgtaccagtgtgcatcagtccaat
caggcccgtggggcagggccccctccatccaagccctccaaaaaggcccccaccccagga
ggggcccagtttgtgggcctggagctctacaagagactcaaggagttcctcaagaactac
ctgaccaacctgctcaaggatggagaagacctgatggatgagagtgtattaaagttctac
acacagcagtgggaagactacagattctccagcaaagtgctgaatggcatctgtgcctac
ctcaaccgacactgggtccgccgcgagtgtgatgaggggcgcaaagggatatatgaaatc
tactccctcgcattggtgacatggagagaatgccttttcagacctttgaataaacaagtc
acaaatgctgtattaaagctcattgagaaggaacgtaacggagagaccatcaacactagg
cttatcagtggagtcgtccagtcctatgttgagttgggtctcaatgaggatgatgccttt
gccaaaggtcccacgttgtcagtctacaaagagtacttcgagactcagttcttggcggac
accgagcgcttttacacacgagagagcacagagttcctgcaacaaaatccagttactgaa
tacatgaaaaaggctgaggcgcgtctgttggaggagcagcggagggtgcaggtgtacctc
catgagagcacgcaggacgagctcgcccgcaagtgtgagcaggtgctcatcgagaagcac
ctggagatcttccacacagagttccagaaccttctggatgctgacaaaaatgaagacctt
gggcggatgtacaatttggtgtcccggatcactgatggattgggagagctgaagaaactc
ctggagacgcacatatacaaccagggccttgctgctatagagaagtgtggagaagcagct
ctcaatgatcccaaaatgtatgtccagaccatcttagacgtccacaagaagtataatgct
ttagtaatgtcagcgttcaacaacgatgctggttttgttgctgctctggacaaggcctgt
ggacgcttcataaacaacaatgctgtgaccaagatggtgcagtcatccagcaaatcccca
gagctgctggctagatactgtgactctctgctgaagaagagctcaaagaacccagaggag
gcagagctagaagacacactaaaccaagtgatggtggttttcaagtacatagaggacaaa
gatgtgttccagaagttctacgccaagatgctggctaagcggttagtccatcagaacagc
gccagtgatgatgctgaagccagtatgatctccaaactaaagcaagcgtgtggcttcgag
tatacctccaaactccaacgcatgttccaggacatcggagtcagcaaagacctaaatgaa
caatttaaaaagcacctcaccaactctgagcctttggacttggacttcagcatccaggtc
ctcagttctggttcctggcccttccagcagtcctgtacatttgccttgccctctgagctg
gagaggagttaccagcggttcactgccttctacgccagcagacacagcgggcgcaagctg
acctggctctaccacctgtccaaaggagagctggtcaccaactgctttaagaacagatac
actctgcaggcttctaccttccagatggccatcctattgcagtacaatgctgaggacgtc
tacacagtgcagcagctcgctgacagcacacagatcaagatagacattttggtgcaggtg
ttgcaaatcttgttgaagtccaaattgctggtcctggaggatgagaatgcaaatgtggat
gaagtggagttcaaaccagacaccttaataaaactcttcctgggatacaaaaacaaaaaa
cttcgggtgaacattaacgtgccaatgaagacagagcagaagcaggagcaggaaaccact
cacaagaacatagaggaggacaggaaactgttaatacaggctgccattgtgagaatcatg
aagatgcgcaaagtgctgaaacatcagcaactcctggcagaggtgctgaatcagctgtca
tccaggttcaaaccaagagtccccgtcatcaagaaatgtatcgacatcctgatcgagaag
gagtacctggagcgtgtcgacggagagaaagacacttacagctacttggcttaa

KEGG   Salmo salar (Atlantic salmon): 106578388
Entry
106578388         CDS       T04363                                 

Definition
(RefSeq) cullin-1-like
  KO
K03347  cullin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04141  Protein processing in endoplasmic reticulum
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106578388
   04120 Ubiquitin mediated proteolysis
    106578388
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106578388
   04340 Hedgehog signaling pathway
    106578388
   04350 TGF-beta signaling pathway
    106578388
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106578388
   04114 Oocyte meiosis
    106578388
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106578388
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     106578388
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 106578388
NCBI-ProteinID: XP_014012610
UniProt: A0A1S3NBG8
LinkDB
Position
ssa19
AA seq 776 aa
MSSNRGQNPHGLKQIGLDQIWDDLRAGIHQVYTRQSMAKSRYMELYTHVYNYCTSVHQSS
QGRGSAVPNKPSKKSSTPGGAQFVGLELYKRLKEFLKNYLTSLLMDGEDLMDECVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEEDAFAKGPTLSVYKEYFECQFLTDT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARRCEQVLIEKHL
EIFHTEFQNLLDADKNQDLGRMYNLVSRITDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKVYVQTTLNVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNTVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYGSRHSGRKLTWLYHLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDLYSVQQLTDSTQIKTDILVQVLQILLKSKLLVLEDENANIDE
VEFKPETLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgtcgtccaacaggggccagaacccacatgggctgaagcagatcgggctggaccagatc
tgggacgacctgagggctggcatccaccaggtgtacacacggcagagcatggcgaagtcg
cgctacatggagctctacacccatgtgtataactactgtaccagcgtgcaccagtccagt
caaggccggggatctgccgtccccaacaagccctccaagaagagcagtactcctgggggg
gcccagttcgtaggcctggaactctacaagagactcaaggagttcctcaagaactacctc
accagtctgctcatggatggtgaggacctgatggatgagtgtgtgttgaagttctacaca
cagcagtgggaggactaccggttctctagtaaggtgctgaatgggatctgtgcttacctc
aacaggcactgggtcagacgtgaatgtgacgagggacgcaagggcatctatgagatctac
tcgttggctttggtaacgtggagggagtgtctattcagacccctaaacaaacaggtaacg
aatgcggtcctgaagctcatcgagaaggagaggaatggagagaccatcaacaccagactt
atcagtggtgtggtgcagtcctacgtggagctggggctgaatgaggaggatgcgtttgct
aagggtcctacgctgtcggtgtataaagaatactttgagtgccagttcctcacggacacc
gaacgcttctacacacgagagagcaccgagttcctccaacagaaccctgttactgagtac
atgaagaaggccgaggcccgtctgctagaggaacagagacgtgtgcaggtgtacctccat
gagtccactcaggatgagctggccaggcggtgtgaacaggtgctcatagagaaacacctg
gagatcttccacacagagttccagaatctactggatgctgacaagaaccaagatctaggt
cggatgtataacttggtgtctcgtataacggatggcctgggagagctaaagaaactccta
gaaacacacatccacaaccagggcctggcagctatagagaaatgtggagaggccgctctc
aacgaccctaaggtgtatgtccagaccacactgaacgtccataagaagtacaacgctctg
gtcatgtctgccttcaacaacgacgctggcttcgtagctgctctagacaaggcgtgtggt
cgtttcatcaacaacaacacggtcactaagatggcccagtcctccagtaaatcacctgaa
ctactggctagatactgtgactctctgctcaagaagagttctaagaacccagaagaggca
gagttggaggacacactcaaccaagtgatggtggtgtttaagtacatagaggacaaggat
gtgttccagaagttctatgctaagatgctggctaaacgcctcgtccaccagaacagtgct
agcgatgacgcagaggctagcatgatctccaaactcaagcaagcgtgtggctttgagtac
acatctaaactacagaggatgttccaggacatcggagtcagcaaagacctcaacgaacag
ttcaagaaacacctgaccaactctgaacctctcgacttggacttcagtatccaggtgttg
agttccgggtcctggccgttccagcaatcatgcaccttcgctctgccctccgagctggag
cgtagctaccagcggttcaccgcattctacggcagcagacacagcggtcggaaactcacc
tggctctaccacctgtctaaaggagagctggtcaccaactgctttaaaaacaggtacact
ctgcaggcctctaccttccagatggctatcctgctgcagtacaacacagaggacctgtac
tccgtacaacaactcactgacagcacacagatcaaaaccgacattctggttcaagtgttg
cagatcttgttgaaatccaaattgctggtcctggaggatgagaatgctaacatagacgag
gtggagttcaaaccagaaaccctgatcaaactcttcctgggatacaagaataagaagctg
cgtgtgaacattaacgttccaatgaagactgaacagaaacaggagcaggagaccacacac
aagaacatagaggaggaccgcaagctcctcatacaggctgccatagtgaggataatgaag
atgaggaaggttctgaaacaccagcagctcctggctgaagtcctaaaccagctctcgtcc
cgcttcaaacccagagtccctgtcattaagaagtgtatagacatcctgatagagaaggag
tatctggagagagtggatggagagaaagacacgtacagctacctggcttaa

KEGG   Salmo salar (Atlantic salmon): 106599302
Entry
106599302         CDS       T04363                                 

Definition
(RefSeq) cullin-1
  KO
K03347  cullin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04120  Ubiquitin mediated proteolysis
sasa04141  Protein processing in endoplasmic reticulum
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106599302
   04120 Ubiquitin mediated proteolysis
    106599302
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106599302
   04340 Hedgehog signaling pathway
    106599302
   04350 TGF-beta signaling pathway
    106599302
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106599302
   04114 Oocyte meiosis
    106599302
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106599302
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     106599302
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 106599302
NCBI-ProteinID: XP_014045938
UniProt: A0A1S3R2I7
LinkDB
Position
ssa03
AA seq 777 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKARYMELYTHVYNYCTSVHQSN
QARGAGPPPSKPSKKAPTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFY
TQQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRECLFRPLNKQV
TNAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLSVYKEYFETQFLAD
TERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKH
LEIFHTEFQNLLDADKNEDLGRMYNLVSRITDGLGELKKLLETHIYNQGLAAIEKCGEAA
LNDPKMYVQTILDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMVQSSSKSP
ELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNS
ASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQV
LSSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYHLSKGELVTNCFKNRY
TLQASTFQMAILLQYNTEDVYTVQQLTDSTQIKIDILVQVLQILLKSKLLVLEDENANVD
EVEFKPDTLIKLFLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIM
KMRKVLKHQQLLAEVLNQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtcatccaacagaagccagaaccctcatgggctgaaacagattggcctagaccagatc
tgggatgacctgcgagcaggaatacagcaggtgtacaccagacagagcatggccaaagca
cgatacatggaactctacacacacgtttataactactgtaccagtgtgcaccagtccaat
caggcccgtggggcagggcccccgccatccaagccctccaaaaaggcccccaccccagga
ggggcccagtttgtgggcctggagctctacaagagactcaaggaattcctcaagaactac
ctgaccaacctgctcaaggatggagaagacctgatggatgagagtgtattaaagttctac
acacagcagtgggaagactacagattttccagcaaagtgctgaatggtatctgtgcctac
ctcaaccggcactgggtccgccgcgagtgtgacgaggggcgcaaagggatctatgaaatc
tactccctcgctttggtgacatggagggaatgccttttcagacctttgaataaacaagtc
acaaatgctgtattgaagctcatcgagaaggaacgtaacggagagaccatcaacaccagg
cttatcagtggagtcgtccaatcctatgttgagttgggcctcaatgaggacgatgccttt
gccaaaggccccacattgtcggtctacaaagaatactttgagactcagttcttggcggac
accgagcgcttctacacacgagagagcacagagttcctgcaacaaaaccctgttactgag
tacatgaagaaggcggaggcacgtcttttggaggagcagcggagggtgcaagtgtacctc
catgagagcacgcaggacgagctggcccgcaagtgtgagcaggtgctcatcgagaagcac
ctggagattttccacacagagttccagaatcttcttgacgctgacaaaaatgaagacctt
gggcggatgtacaatttggtgtcccggatcactgatgggttgggagagctgaaaaaactc
ctggagacgcacatatacaaccagggccttgctgctatagagaagtgtggagaagcggct
ctcaatgatcccaaaatgtatgtccagaccatcttagacgtccacaaaaagtataatgct
ttagtaatgtcagcgttcaacaacgacgctggttttgttgctgctctggacaaggcctgt
ggacgcttcataaacaacaatgctgtgaccaagatggtacagtcgtccagcaaatcccca
gagctgctggctagatactgtgactctctgctgaagaagagctcaaagaacccagaggag
gcagagctggaagacacactaaaccaagtgatggtggtctttaagtacatagaggacaaa
gatgtgttccagaagttctacgccaagatgctggctaagcgtttagtccatcagaacagc
gccagtgacgatgctgaagccagtatgatctccaaactgaagcaagcgtgcggcttcgag
tacacctctaaactccagcgcatgttccaggacatcggcgtcagcaaagacctaaatgaa
caattcaaaaagcacctcaccaactctgagcctttggacttggacttcagcatccaggtc
ctcagttctggttcctggcccttccagcagtcctgtacatttgctttgccctctgagctg
gagaggagttaccaaaggttcacggccttctacgccagcagacacagcgggcgcaagctg
acctggctctaccacctgtccaaaggagagctggtcaccaactgctttaagaacagatac
actctacaggcttctaccttccagatggccatcttactacaatacaacactgaggacgtc
tacacagtgcagcagctcactgacagcacgcagatcaagatagacattttggtacaagtg
ttgcaaatcttgttgaagtccaaattgctggtcctggaggatgagaatgcaaatgtggat
gaagtggagttcaaaccagacaccttaataaaactcttcctgggatacaaaaacaagaaa
cttcgggtgaacattaacgtgccaatgaagacagagcagaagcaggagcaggaaaccact
cacaagaacatagaggaggacaggaaactgctaatacaggcagccatcgtgagaatcatg
aagatgcgtaaagtgctgaaacatcagcagctcctggcagaggttctgaaccagctgtca
tccaggtttaaaccaagagtccccgtcatcaagaaatgcatcgacatcctgatagagaag
gagtacctggagcgtgtcgacggagagaaagacacttacagctacttggcttaa

DBGET integrated database retrieval system