KEGG   Salmo salar (Atlantic salmon): 106569312
Entry
106569312         CDS       T04363                                 

Definition
(RefSeq) epidermal growth factor receptor-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04068  FoxO signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106569312
   04012 ErbB signaling pathway
    106569312
   04068 FoxO signaling pathway
    106569312
   04020 Calcium signaling pathway
    106569312
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106569312
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106569312
   04520 Adherens junction
    106569312
   04540 Gap junction
    106569312
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106569312
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106569312
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106569312
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106569312
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106569312
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   106569312
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106569312
  Exosomal proteins of pancreatic cancer cells
   106569312
  Exosomal proteins of bladder cancer cells
   106569312
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kdo Kinase-like APH LapA_dom
Other DBs
NCBI-GeneID: 106569312
NCBI-ProteinID: XP_013996010
UniProt: A0A1S3LYR8
LinkDB
Position
ssa14
AA seq 1219 aa
MNTTNTMATQFQIWIIFTSLISYALPEKKVCQGVTNRFSLLGSKEDHYLNMVKTYSNCTV
VLENLEVTYMEDYHDLSFLRSIQEVGGYVLIALNTANRIPLDSLRIIRGHTLYDSGFALA
VVLNYNKSMRAGTTELPLTSLTEILKGGVKFSDNQLCNVETIQWLDIVNSNSKPNMQLPE
PSNNRLCKRCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCQGPSPIDCCNEHCAAGC
TGPRPTDCLACRDFQDDGMCKDSCPRLLLYDRNLHQLVNNPDGKYNFGATCVKTCPHNYV
VTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGKLANILSINATNIDTFK
NCTKINGNIAIIYTSIHGDTFTKAPKMDPAKLEVFKTVREITGYLLIQNWPENMTSLSPF
ENLEIIRGRTKRVLLSLAITQLTITHLGLRNLKEISDGDVVIAKNPNLCYTKNHHWKQLF
KSDTQTARLENNADGADCGMQNNTCDRMCTRDGCWGPGPTMCFACQDYSRAGSCVDSCNL
LEGEPRETEVNKTCVECHLECQLLNGTQTCSGPGHEQCTRCANFKDGDNCVPWCPRGVAG
GKNTFIWKYADKMKVCQLCHQNCTEGCTGPGLKGCQSKGNSGLSVIAAGVVGGMLAFLIM
GLSVFVLLRRRHIKKKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWVPEGEDVKISVAIKVLREATSPKANKEILDEAYVMASVDHPHVCRLLGI
CLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLEEHHLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLNSDEKEYHADGGKVPIKWMALESILYRTYTHQSDVWSY
GVTVWELMTFGTKPYDGIPASEVAGVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPR
FRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYRSLISGEDMEDAVDADEYLVPQ
HGFFSSSSTSRTQLLHSTSQNSTLNSSIGMCHSRNGNGFPVREGSMVLRYIADPTDRFLD
HAFQPSPDYINQNGVSDMMNPVYQHPGPPRTLLPTISSDDTEAEYLNCYKNGAVGPEYLN
TLQPSLLSPTTSNGLNPTANGHSPISNGLLSPTSNGGLHRVQKNQPQNSIDNPDYQQDFT
PSIKMHIPAAENAEYVGPN
NT seq 3660 nt   +upstreamnt  +downstreamnt
atgaatacgacaaataccatggctacacagtttcaaatctggatcattttcacctctttg
atctcctatgctttgccggaaaagaaagtgtgccagggcgtcactaaccggttcagcctg
cttgggtcaaaagaggaccactacctgaacatggtcaagacctacagcaactgcactgtg
gtccttgagaacctggaggtcacatacatggaggactaccatgatctatctttcctcagg
tccatccaggaggtgggtggctacgttctgatcgccctcaacacagccaacaggattccc
ctggacagcctgcgcatcatccgaggccacactctctatgacagtggctttgccctggct
gtggtgctgaactataacaagtccatgcgagcaggcaccactgagctgcctctgaccagc
ctcacagagatcctgaaaggaggagtgaagttctcagacaaccagctgtgtaacgtggag
accatccagtggttggacattgtaaacagtaacagcaaacccaacatgcagttacctgaa
cccagcaacaatcggctctgtaaaagatgtgatcctggatgcttcaatggttcctgttgg
gcgcccggcccagaacactgccagacgttgacgaagctgaactgtgcccagcagtgctct
aagagatgtcagggtccgtcccccatcgactgctgcaacgaacactgtgctgcaggctgc
actggacccagacctacagactgtctggcttgccgtgactttcaggatgatgggatgtgt
aaagactcgtgtccccgcctcctgctctacgaccgcaaccttcaccaattggtcaacaac
ccagacgggaagtacaacttcggggccacctgcgtcaagacttgtcctcataactatgtg
gtgacggaccatggagcgtgcgttcggacgtgcagtggtgacacatacgaggtggacgag
ggaggggtcaggaagtgcaagaagtgtgatggactgtgccccaaagtttgcaatggactt
ggaatggggaaacttgccaatattctgtcaattaatgccaccaacattgacacatttaaa
aactgtaccaaaatcaatgggaacattgctattatctacacatctatccatggggacacg
ttcaccaaagcacctaagatggatccggccaagctagaagttttcaagacggtcagagaa
attaccgggtacttgctgattcagaactggcctgagaacatgacgtccctcagtccattt
gagaacctggagatcatccgtggacggaccaagcgtgttctgttgagcttggccataacc
cagttaaccatcacccacctggggctgcgtaacctgaaggagatcagtgacggagacgtg
gtcattgcaaaaaaccccaacctctgctacaccaagaatcaccactggaagcagttgttc
aagtccgacactcagaccgcccggctggagaacaacgccgacggagccgactgcgggatg
cagaacaacacgtgtgacaggatgtgtaccagagatggctgctggggccctggacccacc
atgtgtttcgcctgtcaggactacagccgagcaggaagctgtgtcgactcctgcaaccta
ctggagggggagccacgtgagactgaagtgaataagacgtgtgtagagtgtcaccttgag
tgtcagctcctcaacgggacccagacctgctctggaccaggccatgagcagtgtacccgg
tgtgccaacttcaaagatggcgacaactgtgtcccgtggtgccctagaggggtggctggg
ggcaagaacaccttcatctggaaatacgcagataagatgaaggtgtgccagctgtgccac
cagaactgtaccgagggatgtactggtcctggtctgaaaggctgtcagtctaaaggtaac
tctggcctgtcagtgattgcagctggtgtggtgggcgggatgctggcctttctcatcatg
ggcctgtctgtcttcgtgttgctacgacgacgccacatcaagaagaagaggaccctgcga
agactcctccaggagagagagttagttgaaccgctgacccccagtggtgaggcgcccaac
caggctctgctccgtatcctgaaggagacagagtttaagaagatcaaagttttgggatca
ggggccttcggcactgtctacaagggtctgtgggtccctgaaggagaggatgtgaagatc
tctgtggccatcaaggttttaagagaggccacatcacctaaagccaacaaggagatcttg
gacgaggcctatgtgatggccagtgtggaccacccccatgtttgtcgtctactgggcatc
tgcctgacctccacagtccagctggtcacccagctcatgccctacggctgtctgctggac
tatgtcaaggagaacaaggacaacattggatcccagtacctcctcaactggtgtgtacag
atagccaaggggatgagctacctggaggagcatcacctggtgcatcgtgacctggcagcg
aggaacgtcctggtgaagacccctcagcatgtcaagatcactgacttcggcctggccaaa
ctcctcaactctgacgagaaggagtaccatgcagacggaggaaaggtaccaatcaaatgg
atggcactggagtccatcctctaccggacatatacacatcaaagtgacgtgtggagctat
ggtgtgaccgtgtgggagctgatgacatttgggaccaagccctatgacggcatcccagcc
agtgaggtagcaggggtgctggagaaaggggagcggctgccccagcctcccatctgtacc
atagacgtctacatgatcatggtcaaatgttggatgatcgacgcagacagcaggcctcgt
ttccgggagctgatagctgagttttccaagatggcgcgggatcccccacgttaccttgtc
atccagggtgacgaccggatgcacctccccagccccaccgacaccaagttctaccgcagt
ctgatcagtggagaggacatggaagatgctgtggacgcagacgagtacctagtgcctcag
cacggcttcttcagtagctccagtacctcccgcacccagctcctacactctacgagccag
aacagcacgttgaacagcagcattggaatgtgccacagcagaaatgggaacgggttccca
gtcagagaaggaagcatggttctccggtacattgctgaccccacagacaggttcttggac
catgccttccagccatctccagactacattaaccagaacggagtttcggacatgatgaac
cctgtataccagcaccctggtccccctcgcaccctcctccccaccatatcctcagacgac
acagaggcagagtacctgaactgctataagaacggggcagtggggcctgagtacctcaac
accctccagccctccctcctctcccccaccacctccaatggcctcaaccccactgctaac
ggccattcccccatatccaatggtctcctctcccccacctccaatggtggtctccaccgc
gtccagaaaaaccagccccaaaacagtatagataacccagactaccagcaggacttcacc
ccctccatcaagatgcacatcccagccgcagagaacgcagagtacgtgggtccaaactga

KEGG   Salmo salar (Atlantic salmon): 106579586
Entry
106579586         CDS       T04363                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04068  FoxO signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106579586
   04012 ErbB signaling pathway
    106579586
   04068 FoxO signaling pathway
    106579586
   04020 Calcium signaling pathway
    106579586
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106579586
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106579586
   04520 Adherens junction
    106579586
   04540 Gap junction
    106579586
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106579586
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106579586
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106579586
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106579586
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106579586
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   106579586
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106579586
  Exosomal proteins of pancreatic cancer cells
   106579586
  Exosomal proteins of bladder cancer cells
   106579586
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 106579586
NCBI-ProteinID: XP_014015111
UniProt: A0A1S3NIU7
LinkDB
Position
ssa19
AA seq 1229 aa
MRPGTGIVIAALFSLGCSMTLTADKKVCQGISNRLTLLGTVDDHYNNLVRMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIAVNKAAIIPLENLRLIRGHSLYDNKYALAVMS
NYEKNHSSVTLNYTRGLRELMLRGLTDILKGGVKIAHNPLLCNVETIQWWDMVNKAGNPS
MEFKLESYGRYCGKCDPGCYNGSCWTPGPENCQTFTKLKCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMIYNPNTHQLASNPNAKYTFGATCVKTC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCNGLGMGPLTAVLSINASN
IDSFKNCTKINGDVSIIGTSLNGDRYTSTPKMDPAKLDYFRTVKEISGFLLIQAWPKHLD
SLSAFENLEIIRGRTKQFGQVSFAALNVAHLKYLGLRSLREISDGNIVVKNNPHLCYTNG
GHWNGLFRLDKQFARVDNNANNSTCAQLNSTCDDMCTKEGCWGPGPTMCLTCLYYARRGR
CVGACHVLEGAPREYVLNNMCLECDQECMVKNRTGSCFGSGPDKCVECAHVKDGPHCVYR
CPRGVLGDGDRPIWKYADKNRECQLCHENCTDGCSGPGLNGCNARGGPVPSVVAASVVGG
LLVFVVLALGVFVLVRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFK
KIKVLGSGAFGTVFKGVWIPEGENMKIPVAIKVLREATSPKANKEILDEAYVMASVEHPH
VCRLLGICLTSTVQLITQIMPYGCLLDYVKENKDLIGSQCLLNWCVQIAKGMNYLEERHL
VHRDLAARNVLVKTPHHVKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTH
QSDVWSYGVTLWELMTFGSKPYDGIQAREIAGVLEKGERLPQPPICTIDVYMIMVKCWMI
DADSRPRFRELISEFSKMARDPSRYLVIQGDDCMYLPSPTDSKFYRSLISTSEDMEDVVD
AEEYLLPDKTTQHHNSGVNTHVQTNTHTHTRLMFEFSICSPQNGHLMRENSVILRYITDP
THGGSLEKDITDPTHSGSLKKDITDPIHCGSLEQDLSALPEYMNQDTKHSDVFNPNYEDP
SEPAWATRTSSGYDPDNKFFNSLPRVPEGPEYLNMARSTLPRSVGESMDNPDYQEDFLPQ
ATPTSSHFLPAAENLEYLGLSAAVHTPVR
NT seq 3690 nt   +upstreamnt  +downstreamnt
atgcgacctggaactggaatagttattgctgccttgttcagcctgggctgcagcatgaca
ctgacagcggacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggggact
gtagacgaccactacaacaacctggtgaggatgtacagcaactgtaccgtggtcctggag
aacctagagctcacctacatccaggactaccacgacctgtccttcctcaagtccattcag
gaggttggaggctatgttctgatcgccgtcaacaaggcggccatcatcccactggagaac
ctgcgtctgatccgaggacactccctctatgacaacaagtacgccctggctgtcatgtcc
aactacgagaagaaccactcctctgtgacccttaactacacccggggcctgagggagctg
atgctgagaggactgacagacattctcaagggaggggtgaaaattgcccacaatcctttg
ctgtgtaatgtggagaccatccaatggtgggacatggtaaacaaggccggcaaccccagt
atggagttcaaactggagagctatggccgttactgtggcaagtgtgaccctggatgctac
aatggatcatgctggacaccaggaccagagaactgtcaaacatttaccaagctgaagtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcctgcagagacttccag
gatgatggcacatgtaaggacgcctgccctcctaccatgatctacaatcccaacacccac
cagctggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaagacctgc
ccacataactatgtggtgacggaccacggggcgtgtgtccgaacatgcagtggcaacaca
cacgaggtggaggagaatggtgtcaggaggtgcaagaagtgtgatggaatctgtccaaaa
gtgtgcaatggacttggaatggggccgcttactgccgtcttgtcaatcaacgcctctaac
attgattctttcaaaaactgcaccaaaatcaatggcgatgtttcaataattggaacctct
ttgaatggtgataggtacacatcaacaccaaaaatggaccctgccaaactggattatttc
agaactgtgaaggagatttcagggtttctgctcatacaagcttggccaaagcacctcgat
tctctcagtgcatttgaaaacctggagattatcaggggaaggaccaaacagtttggtcag
gtgagttttgctgccctcaacgtggcccatctgaagtatctaggcctccgctccttacga
gagatcagcgatggcaacattgtggtgaagaacaacccccacctctgctataccaacgga
ggccactggaatggcctgttcagactggacaaacagttcgcaagggtggacaacaacgcc
aacaacagcacatgtgcccagctgaacagtacctgtgatgacatgtgcactaaggagggc
tgctgggggcccggtcccaccatgtgtttaacctgcctgtactacgcccgtaggggccgc
tgtgtcggggcctgtcacgttctggagggggcgccaagagagtatgtgttgaacaacatg
tgcctagagtgtgaccaagaatgtatggtgaagaacagaaccggaagctgctttggttct
ggccctgacaagtgtgtggagtgcgcccacgtcaaagatggcccccactgtgtctatcgg
tgcccacgtggcgttctcggggacggggacaggcccatctggaaatacgctgacaagaac
agagaatgtcagctctgccatgagaactgcaccgacggatgctctggacctggactgaat
ggctgcaatgccagaggtggtcccgtcccgtcggtggtggcggccagtgtggtgggaggc
ctcctggtgtttgtggtcctggccttgggtgtattcgtgctagtccgcagacgtcacatc
gtcaggaagaggacgctgcgccgcctgctgcaggaaagagagttggttgaacccctgacc
ccaagtggagaggcacccaaccaggccctgctccgcattctgaaggagaccgagtttaag
aagatcaaagtgttgggatcaggggcctttggaactgtctttaagggcgtgtggattcct
gagggagaaaacatgaagatccctgttgccattaaggtgttgagagaggccacatctccc
aaagccaacaaggagattctagacgaggcctatgtgatggccagtgtggagcacccccac
gtatgtcgtctgctgggcatctgcctgacgtccacagtgcagctcatcacccagatcatg
ccctatggctgcctgctggactatgtcaaggagaacaaggacctcatcggctcccagtgt
ctactcaactggtgtgtacagatcgcaaagggtatgaactacctggaggaacgtcaccta
gtgcaccgtgacctggcggccaggaacgttctggtgaagacacctcaccatgtgaagatc
acagactttggactggccaagctgctcaccgccgacgagaaggagtaccatgctgatggg
gggaaggtgcccataaagtggatggcactggagtccatccttcactggacctatacccat
cagagtgatgtgtggagctacggtgtgacattgtgggagctgatgacgtttgggtcgaag
ccctacgatggcatccaggccagggagatcgctggagtcctggagaaaggagagcgccta
cctcagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatc
gatgcagacagcagaccacggttcagagagctcatctctgagttctccaaaatggcccgg
gatccatctcgctatctggtcattcagggagatgattgcatgtacctccccagtcctacg
gactctaagttctaccgtagcctgatcagtacatcagaggacatggaggatgtggtagat
gccgaggagtatcttctccccgacaagaccacccagcaccacaactcaggggtaaacaca
cacgtgcaaacaaacacacacacacacacacggctgatgtttgaattttcgatctgctca
ccacagaatggccatctgatgagagagaacagtgtgatccttcgctacatcacagacccc
acccacggtggttctctcgagaaagacatcacagaccccacccacagtggttctctaaag
aaagacatcacagaccccatccactgtggttctctagagcaagatctctctgctcttcca
gaatacatgaaccaggacaccaagcactctgatgtcttcaaccccaactatgaggacccc
agcgagccagcctgggctactcggacctcctctgggtacgacccggacaacaagttcttc
aactccctgccgcgcgtgccggagggacccgagtatctcaacatggcccgcagtaccctc
cctcgctctgtaggtgagagcatggacaacccagactaccaggaggacttcctgcctcag
gccacacccaccagtagtcacttcctgcccgcagcagagaacctggagtacctcggattg
agtgctgctgtacacacccctgtacgctag

KEGG   Salmo salar (Atlantic salmon): 106590362
Entry
106590362         CDS       T04363                                 

Definition
(RefSeq) melanoma receptor tyrosine-protein kinase-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04068  FoxO signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106590362
   04012 ErbB signaling pathway
    106590362
   04068 FoxO signaling pathway
    106590362
   04020 Calcium signaling pathway
    106590362
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106590362
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106590362
   04520 Adherens junction
    106590362
   04540 Gap junction
    106590362
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106590362
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106590362
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106590362
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106590362
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106590362
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   106590362
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106590362
  Exosomal proteins of pancreatic cancer cells
   106590362
  Exosomal proteins of bladder cancer cells
   106590362
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH
Other DBs
NCBI-GeneID: 106590362
NCBI-ProteinID: XP_014036776
UniProt: A0A1S3QA06
LinkDB
Position
ssa29
AA seq 1193 aa
MRPETGIVIAAMFCMGCCVTLTAHKKVCQGISNRLTLLATVDDHYNNLVKMYSNCTVVLE
NLELTYIQDYHDLSFLKSIQEVGGYVLIALNKAASIPLENLRLIRGHSLFLDKYALTVTS
NYEKNHSSVTLNYTRGLRELKLSGLTEILKGGVKIAHNPLLCNVETIQWWDMVNKAINHS
MHFKLESYGRYCDKCDPGCYNGSCWTSGLENCQTFTKLTCAEQCSGRCRGPKPSDCCNEH
CAAGCTGPRPTECLACRDFQDDGTCKDACPPTMLYNPNTHQLASNPNAKYTFGATCVKDC
PHNYVVTDHGACVRTCSGNTHEVEENGVRRCKKCDGICPKVCDGLGMGLLTKVLSINASN
IDSFKNCTKINGAVSIMQTSLDGDRYTSTPKMDPAKLEYFKTVKEISGFLLIQAWPEHLD
SLSPFENLEIIRGRTKQFGRVSFAALNLAHLKYLGLRSLREISDGNVVVKNNPQLCYTNG
DHWKSLFRLGKQSSTVGNNVNISTCAKLNSTCDEMCTDEGCWGPGPTMCFTCLYYTRRGR
CVGACNLLEGVPREYVLNNRCLECDPECLVNGPQSCFGPGPDKCLACAHVKDGPHCVYQC
PHGVLGDRDRHIWKYTDKKRECQLCHENCTQGCSGPGLSGCSTRGGHVASVVVARVVGGL
LVFVVLALGVFVLLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKK
IKVLGSGAFGTVFKGMWIPEGENVKIPVAIKVLREATSPKANKEILDEAYVMASVEHPHV
CRLLGICLTSTVQLITQIMPYGCLLDYVKENKDNIGSQCLLNWCVQIAKGMNYLEEHHLV
HRDLAARNVLVKTPHHLKITDFGLAKLLTADEKEYHADGGKVPIKWMALESILHWTYTHQ
SDVWSYGVTVWELMTFGSKPYDGIPAIEIAGVLEKGERLPQPPICTIDVYMIMVKCWMID
AESRPRFRELISEFSKMARDPSRYLVIQGDDRMYLPSPTEPMFYRSLISTSENMEDAEEY
LHPYKDLSTRQTTQHHNSRNGHPMRENSVILRYITDPTHGGSLEKDITDPSGSLEKDFPA
LPEYMNQNGNTRLSDVFNPSYEDPTEAAWASRPSSGYDPDVKFFNFLPCMLEIPEYHNMA
RSTLPRSVCERMDNPDYQEDFLPQATPTSSHFLPAAENLEYLGLSAAVHAPVR
NT seq 3582 nt   +upstreamnt  +downstreamnt
atgcgacctgaaactggaatagttattgctgccatgttctgcatgggctgctgcgtgaca
ctgacagcgcacaagaaagtgtgtcaggggatcagcaacaggctgacgctgctggcgact
gtagacgaccactacaacaacctggtgaagatgtacagcaactgtaccgtggtcctggag
aacctggagctcacctacatccaggactaccacgacctctccttcctcaagtccattcag
gaggttggaggatacgttctgatcgccctcaataaggcagccagcatccctctggagaac
ctgcgtcttatccgaggacactccctcttccttgacaagtatgccctgactgtaacgtcc
aactacgagaagaatcactcctccgtgaccctcaactacacccggggcctgagggagctg
aagctgagtggactgacagagattctcaagggaggtgtgaaaattgcccacaatcctttg
ctgtgtaatgtggaaaccatccagtggtgggacatggtaaataaggccataaaccatagt
atgcacttcaaactggagagctatggccgttactgtgacaagtgtgacccgggatgctac
aatggatcgtgctggacctcaggactagagaactgtcaaacctttaccaagctgacgtgt
gcagagcagtgctctggaaggtgtaggggtcctaaacccagtgactgctgtaacgaacac
tgtgctgcaggctgcaccggccctaggcctacagagtgtctggcttgtagagacttccag
gatgacggcacatgtaaggatgcctgcccccctaccatgctctacaatcccaacacccac
cagttggcttccaaccctaacgccaagtacacgttcggggccacttgtgtgaaggactgc
ccacataactatgtggtgacggaccacggggcgtgtgtcagaacgtgcagcggcaacaca
cacgaggtagaggagaatggtgtcaggaggtgcaagaagtgtgacggaatctgtccgaaa
gtttgcgatggacttggaatggggctgcttactaaagtgttgtcaatcaacgcgtctaac
attgattctttcaaaaactgcaccaaaatcaatggagccgtttcaattatgcagacatct
ttggatggtgataggtacacatcaacaccaaaaatggaccccgccaaactggaatatttc
aagactgtgaaggaaatttcagggtttttgctgatacaagcttggcccgagcacctcgac
tctctcagtccatttgaaaacctagagattatcagaggaaggaccaaacagtttggtagg
gtgagtttcgctgccctcaacttggcccatctgaagtatcttggcctccgctccctgcga
gagatcagcgatggcaatgttgtggtgaagaacaacccccagctctgctacaccaacgga
gaccactggaagagcctgttcagattgggcaaacagtcctcaacggtgggcaacaacgtc
aacatcagcacctgtgccaagctaaacagtacctgtgatgagatgtgcactgatgagggc
tgctgggggcccggccccaccatgtgttttacatgcctgtattacacccgtagggggcgc
tgtgtaggggcctgtaacctactggagggggtgccacgagagtatgtactgaataacagg
tgtctagaatgtgacccagaatgtctggtgaatggaccacaaagctgctttggaccaggc
cctgacaaatgtttggcgtgtgctcacgtcaaagatggcccccactgtgtatatcagtgc
ccacacggcgttcttggggacagggataggcacatctggaaatacaccgacaagaagcga
gaatgtcagctctgccatgagaactgcacccagggatgctctggacctggactgagtggc
tgcagcaccagaggtggtcacgttgcgtcggtggtggtggccagagtggtgggaggcctc
ctggtgtttgtggtcctcgccctgggtgttttcgtgctgctccgcagacgccacatcgtc
aggaagaggacactgcgccgtctgctgcaggagagagagctggttgaacccctgacccca
agtggagaggcacccaaccaggccctgctccgcattctgaaggagactgagtttaagaag
atcaaagtgttgggatcaggggcttttggaactgtctttaagggcatgtggattcctgag
ggagaaaacgtgaagatccctgttgccattaaggtgttgagagaggccacttcaccaaaa
gccaacaaggagattctagacgaggcctatgtgatggctagcgtggagcacccccacgtg
tgtcgtctactgggcatctgcctgacgtccacggtgcagctcatcacccagatcatgcct
tacggctgtctgctggactatgtcaaggagaacaaggacaacatcggttcccagtgcctg
cttaactggtgtgtgcaaattgccaagggtatgaactacctggaggagcatcacctggtg
caccgtgacctggcggccaggaacgtactggtgaagacgcctcaccacctcaagatcacc
gattttggactggccaagctgctcaccgcagacgagaaggagtaccacgcagatgggggc
aaggtgcccataaagtggatggcactggagtccatccttcactggacctatacacatcag
agcgacgtgtggagctacggtgtgacagtgtgggagctgatgacgtttgggtccaagccc
tacgatggcatcccggccattgagatagctggagtcctggagaaaggagagcgcctgccc
cagccccccatctgtaccatagacgtctacatgatcatggtcaaatgctggatgatcgat
gcagagagcagaccacggttcagggagctcatatcagagttctccaaaatggcccgggat
ccatctcgctatctggtcattcagggggatgatcgcatgtacctgcccagtcccacggaa
cctatgttctaccgtagcctgatcagtacatcagagaacatggaggatgctgaggagtat
cttcacccctataaggacctctccaccagacagaccacccagcaccacaactctaggaat
ggccatccaatgagagagaatagtgtgatccttcgctacatcacagatcccacccacggt
ggttctctagagaaggacatcacagaccccagtggttctctagagaaagatttcccagct
cttccagaatacatgaaccagaatgggaacaccaggctctctgacgtcttcaaccccagc
tatgaggaccccactgaggcagcctgggctagtaggccctcctctgggtacgacccggac
gtcaagttcttcaacttcctgccgtgcatgctggagatcccggagtaccacaacatggcc
cgcagtaccctccctcgctccgtctgcgagcgcatggacaacccagactaccaggaggac
ttcctgcctcaggccacacccaccagtagtcacttccttcctgcagcagagaacctggag
tacctcgggttgagcgctgctgtacacgcccctgtacgctag

KEGG   Salmo salar (Atlantic salmon): 106600426
Entry
106600426         CDS       T04363                                 

Definition
(RefSeq) epidermal growth factor receptor-like
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04068  FoxO signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106600426
   04012 ErbB signaling pathway
    106600426
   04068 FoxO signaling pathway
    106600426
   04020 Calcium signaling pathway
    106600426
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106600426
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106600426
   04520 Adherens junction
    106600426
   04540 Gap junction
    106600426
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106600426
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106600426
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106600426
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106600426
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106600426
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   106600426
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   106600426
  Exosomal proteins of pancreatic cancer cells
   106600426
  Exosomal proteins of bladder cancer cells
   106600426
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like PTE Kdo APH Kinase-like LapA_dom
Other DBs
NCBI-GeneID: 106600426
NCBI-ProteinID: XP_014047241
UniProt: A0A1S3R531
LinkDB
Position
ssa03
AA seq 1250 aa
MKTSFKNTMATQFQIGIIFTSLVSLVSCALPEKKVCQGITNRFSLLGSKEGHYLNMVKTY
SNCTIVLENLEVTHMEDHHDLSFLRSIQEVGGYVLIALNTANRIPLDNLRIIRGHTLYND
GFALAVLMNHNKSMGAGTTELPLTSLTEILKGGVKFSGNQLCNVETIQWLDIVDIDSKPN
MQLPEPNRNRLCKKCDPGCFNGSCWAPGPEHCQTLTKLNCAQQCSKRCKGPSPIDCCNEH
CAAGCTGPRPTDCLACRDFQDDGTCKDSCPRLLLYDRNLHQLVNNPDGKYNFGATCVKTC
PHNYVVTDHGACVRTCSGDTYEVDEGGVRKCKKCDGLCPKVCNGLGMGNLDKILSVNATN
IDTFKNCTKINGNIAIIYTSIHGDPFTKAPKMDPAKLDVFKTVREITGYLLIQNWPENMT
SLSPFENLEVIRGRTKHGMVSLAITQLTITHLGLRSLKEISDGDVVITKNSNLCYTKKRH
WKQLFKSDRQTIQLESNAHPTECGLQNNTCDTMCTRYGCWGPGPTMCFACQDYSRTGSCV
DSCNLLEGEPRETEVNKTCVECHPECQLLNGTQTCTGPGQEQCIQCANFKDGNNCVLGCP
RGVPGVAGGKNTFIWKYADKMKVCQLCHQNCTQGCTGPGLKGCQSIGNSGLSVIAAGVVG
GLLAFLIMGLSVFVLLRRRHIKRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEF
KKIKVLGSGAFGTVYKGLWVPEGEDVKIPVAIKVLREATSPKANREILDEAYVMASVDNP
HVCRLLGICLTSTVQLVTQLMPYGCLLDYVKENKDNIGSQYLLNWCVQIAKGMSYLEERH
LVHRDLAARNVLVKTPQHVKITDFGLAKLLNADEKEYHADGGKVPIKWMALESILHRKYT
HQSDVWSYGVTVWELMTFGTKPYDGIPANEIAGVLEKGERLPQPPICTIDVYMIMVKCWM
IDADSRPRFRELIAEFSKMARDPPRYLVIQGDDRMHLPSPTDTKFYQSLISGEDMEDAVD
ADEYLVPQHSFFSSPSTSRTQLLHSMSQNSTLNSSIGLCHSRNGNGFPVREGSMVLRYIA
DPTDSFLDHAFQPAPDYMNQNGMSDMMNPVYQHPGPPRTLLPTISSDDTETEYLNCYKNE
AVGPEYLNTLQPSLLSPTTSPTTSNGISPITSSGLTTTANSLFPMFNGLSSPSSNGLSPT
SNGGLHCVQKYLPPNSIDNPDYQQDFTPSVKTHANGHIPATENTEYLGPT
NT seq 3753 nt   +upstreamnt  +downstreamnt
atgaagacgagtttcaaaaataccatggctacacagtttcaaatcgggatcattttcacc
tctttggtctccttggtctcgtgtgctttaccggaaaagaaagtatgccagggcatcact
aaccggttcagccttctggggtcaaaagagggccactacttgaacatggtcaagacctac
agcaattgtaccattgtcctggagaacctggaggtcacacacatggaagaccaccatgat
ctgtctttcctcaggtccattcaggaggtgggtggctatgttctgatcgccctcaacaca
gccaacaggattcccctggacaacctgcgcatcatccgaggccacactctctacaacgat
ggctttgccctggctgtgttgatgaaccataacaagtcaatgggagcaggcaccaccgag
ctgcctctgaccagcctcacagagatcctgaaaggaggagtgaagttctcaggcaaccag
ctgtgtaacgtggagaccatccagtggttggacatcgtggacattgacagcaaacccaac
atgcagttacctgaacccaacagaaatcgtctctgtaaaaaatgtgatcctggatgcttc
aatggttcatgttgggcgcccggcccagaacactgccagacattgacgaagctaaactgt
gcccagcagtgctctaagaggtgtaagggtccgtctcccatcgactgctgcaacgaacac
tgtgctgctggctgcactggacccagacctacagactgtctggcctgccgggactttcag
gatgacgggacgtgtaaagactcatgtccgcgcctcctgctctacgaccgcaaccttcac
caactagtcaacaacccagacgggaagtacaacttcggggccacctgcgtcaagacctgc
cctcataactatgtggtgacagaccatggagcgtgcgttcggacgtgcagtggtgacacg
tacgaagtggacgagggaggggtcaggaagtgcaagaagtgtgatggactgtgtcccaaa
gtttgcaatggacttggaatggggaatcttgacaaaattctgtcagtcaacgccaccaac
attgacacgttcaaaaactgcaccaaaatcaatgggaacattgctattatctacacgtct
atccatggggacccatttaccaaagcaccaaagatggatcctgccaagctagacgttttc
aagacggtcagagaaatcactggctacctgctgattcagaactggccagagaacatgaca
tctctcagtccctttgaaaacctggaggttattagaggacggaccaaacatggtatggtg
agcttggccataacccagttaaccatcacccacctgggtcttcgctcgctgaaggagatc
agcgatggagacgtggtcatcaccaagaactccaacctctgctacaccaagaaacgccac
tggaagcagctgttcaagtccgacaggcagaccatacagctggagagcaatgcccaccca
accgaatgcgggctgcagaacaacacgtgtgacacaatgtgtaccagatatggctgctgg
ggacctggacccaccatgtgtttcgcctgtcaggactacagccgaacaggaagctgtgta
gactcctgtaacctacttgagggggagccacgtgagactgaagtgaataagacgtgtgtg
gaatgtcaccctgagtgtcagctcctcaatggaacccagacctgcactggaccaggccaa
gagcagtgtatccagtgcgctaacttcaaagatggcaacaactgtgtcctggggtgccct
agaggggtgccaggggtggcagggggcaagaacaccttcatctggaaatatgcagataag
atgaaggtgtgccagctgtgccaccagaactgtacccagggatgcaccggtcctggtctg
aaaggctgtcagtctataggtaactctggcttatcggtgatcgcggctggagtggtgggt
gggctgcttgccttcctcatcatgggcctgtctgtcttcgtgttgctgcggcgacgccac
atcaagaggaagagaaccctgcgaagactactccaggagagagagttagttgaaccgttg
acccccagtggtgaggcacccaaccaggccctgctccgcattctcaaagagaccgagttt
aagaagatcaaagtgttgggatcaggggccttcggcactgtctacaagggtctgtgggtc
cctgaaggagaggacgtgaagattcctgtggccattaaggttttaagagaggccacatca
cctaaagccaacagggagatattggacgaggcctatgtgatggccagcgtggacaacccc
catgtgtgtcgtctgctgggcatctgcctgacctccacagtgcagctggtcacccagctc
atgccctacggctgtctgctggactacgtcaaggagaacaaggacaacatcggatcccag
tacctcctcaactggtgtgtgcagatcgccaaggggatgagctacctggaggagcgtcac
ctggtgcatcgtgacctggcagcgaggaacgtcctggtgaagacccctcagcacgtcaag
atcacggactttggcctggccaaactcctcaacgctgacgagaaggagtaccacgcagac
ggaggaaaggtaccaatcaaatggatggcactggagtccatcctccacaggaaatacaca
catcagagtgatgtttggagctatggtgtgaccgtgtgggagctgatgacgtttgggacc
aagccctatgacggcatcccagccaatgagatagcaggggtgctggagaaaggggagcgg
ctgccccagcctcccatctgtaccatagacgtctacatgattatggtcaaatgttggatg
atcgacgcagacagcaggcctcgtttccgggagctgatagctgagttttccaagatggcg
cgggatcccccacgttatcttgtcatccagggtgacgaccgaatgcacctcccaagtccc
acagacaccaagttctaccagagcctaatcagtggagaggacatggaggacgctgtggac
gcagacgagtacctggtacctcagcacagcttcttctccagccccagtacctcccgtacc
cagctcctacactctatgagccaaaacagcacattgaacagcagcattggattgtgccac
agcagaaatgggaatgggttccctgtcagagaaggaagcatggttctccggtacattgct
gaccccacagacagtttcttggaccacgccttccagccagctccagactacatgaaccag
aatggcatgtcggacatgatgaaccctgtataccagcaccccggtccccctcgcaccctc
ctccccaccatctcctcagacgacacagagacagagtacctgaactgctataagaacgag
gcagtggggcctgagtacctcaacaccctccagccctctctcctctcccccaccacctcc
cccaccacctccaatggcatctcccccatcacctccagtggcctcaccaccaccgctaac
agccttttccccatgttcaatggtctctcctccccgagctccaatggcctctcccccact
tccaatggcggtctccactgcgtccagaaatacctacccccgaacagtatagataaccca
gactaccagcaggacttcaccccttccgtcaagacccatgccaacggacacatcccggcc
acagagaacacagagtacctaggcccaacctga

DBGET integrated database retrieval system