KEGG   Salmo salar (Atlantic salmon): 106569473
Entry
106569473         CDS       T04363                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106569473
   04217 Necroptosis
    106569473
   04115 p53 signaling pathway
    106569473
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106569473
   04621 NOD-like receptor signaling pathway
    106569473
   04622 RIG-I-like receptor signaling pathway
    106569473
   04625 C-type lectin receptor signaling pathway
    106569473
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106569473
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106569473
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106569473
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     106569473
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106569473
SSDB
Motif
Pfam: Peptidase_C14 CARD HSR
Other DBs
NCBI-GeneID: 106569473
NCBI-ProteinID: XP_013996326
UniProt: A0A1S3LZV2
LinkDB
Position
ssa14
AA seq 427 aa
MVIQSSTNRSIMQTLRKNKTLLTEILSEESSFILQHVQQEEIVTNRDYNNLKIPNQSNEK
TVINLLDKVMNKGNTKCCELVNLLQKPHIIKQCPRLEEIFNNHTKPSDHTFNPAPTVPIP
CTDTSDLEKGVTSGDEVSLYEMTSVPRGLCLIINNEIFDKLGKRTGSNKDAVDLANIFSR
MKFRVVMCKDKTAVEIPIVLKVFSELKQLSDLQQCGAKEWVGGQFTDLKDLPKHGDGFVC
CILSHGEKEGVCGTDGTVVPTIDILSPFNGTNCSILVEKPKLFFIQACRGKDVQPGVPVS
KKPKVEGTDRELDTDNGQVQDYTLPIYSDYLVFMANVEQYISIRNVNTGSWFIQSLCGQL
EKSCTRGKNIYEILTGVKAVVSKKIGDLRIKDANGDYGYEVVKQSPDSRDTLTKILIFPA
ETTHSSC
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggtaattcaatcatccacaaataggtccatcatgcagacgctgagaaagaacaagact
ttgttaactgagatcctgtctgaggaatccagcttcatccttcaacatgtgcagcaggag
gaaatagtgactaatcgtgactacaacaacctaaaaatccccaatcagtctaatgagaag
actgtcatcaacctgctggataaagtgatgaataaaggaaacacaaaatgctgtgaactc
gtgaacctgctgcagaaaccacatattataaaacagtgccctagactggaggaaatattc
aacaatcacacaaaacccagtgaccacaccttcaacccagccccaacagtcccaattccc
tgtacagatacttctgacctggaaaaaggggtcactagtggcgatgaggtcagtctgtat
gagatgaccagtgtaccccgtggtctctgtttgatcatcaacaacgagatatttgataaa
ctgggtaaaagaacaggatcaaacaaggatgctgtggatctggccaacatattcagccgg
atgaagttcagggtggtgatgtgcaaggacaagactgcagtggagattcccattgtgctg
aaggtcttctctgagctgaagcagttatctgacctgcaacagtgtggtgcgaaggagtgg
gtcggtggtcagttcactgatctaaaggatcttcctaagcatggcgatggcttcgtctgc
tgcattctgagtcacggagaaaaggagggcgtctgtggcacagatggaacagtcgtcccc
accattgatatcctctcacctttcaacggcacaaactgtagcatccttgttgaaaagccc
aagctgttcttcatccaagcctgtcgagggaaagacgtgcagccgggtgtgccggtgagc
aagaagcctaaagttgaagggacggacagggaactggacacagacaacggccaagtccaa
gactacacccttccaatatactccgactacctggtgttcatggccaacgtagagcagtat
atctctatcaggaatgtgaacacggggtcctggttcatccagtctctgtgtggccagctt
gagaaaagctgcaccagagggaaaaacatctatgagatccttacaggggtcaaagccgtg
gtgagcaagaaaataggtgaccttcgtattaaagatgctaacggtgattatggctacgag
gtggtcaagcaatcaccagattctagagacaccctgaccaagatactcatctttcctgct
gagaccacgcattcttcctgttga

KEGG   Salmo salar (Atlantic salmon): 106586254
Entry
106586254         CDS       T04363                                 

Definition
(RefSeq) caspase-8-like
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106586254
   04217 Necroptosis
    106586254
   04115 p53 signaling pathway
    106586254
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106586254
   04621 NOD-like receptor signaling pathway
    106586254
   04622 RIG-I-like receptor signaling pathway
    106586254
   04625 C-type lectin receptor signaling pathway
    106586254
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106586254
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106586254
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106586254
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     106586254
Peptidases and inhibitors [BR:sasa01002]
 Cysteine peptidases
  Family C14: caspase family
   106586254
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN
Other DBs
NCBI-GeneID: 106586254
NCBI-ProteinID: XP_014028796
UniProt: A0A1S3PMB3
LinkDB
Position
ssa25
AA seq 581 aa
MDFQRLLLQVEQALSSEEVQALAFLCKDLLDKDLNSVTTASKLFSLLMDQELLSPDQPYL
LADLLLTIQRNSLMRGLGLNNQLPTTSSLISPYRKLLYNLSENITTDELREIKFLLSNEL
PRRKLEDNLTTLQLFLEMEKIDILSIIKLNTLESIFGIVCPMLKTTIKKYKTQNSLAGPG
TQETGVGQFRPRSVSVSVSEAHPGIQAASMLPKRTVFCELSVEQYSHSDETLIPPTYFSS
SQPSAKVSCLNRSDTSLADVRRVSYSMDAVLSHGLSLLSTNGDNCAALIKEYHHVSSTSS
CGDNKNFGPADPQTGNTKREELGEYSMTGKKRGFCLIINNNDFRNSPQLLKEREGTHIDK
KSLVSVFNWLGFETQTEPDCSREKILSLLVELSKRDHSQMDCLVCCVLSHGLEGGVYGVD
GLEVSVRELTKPFSGLECSSLRDKPKLFFIQACQGNKDQKQVFIQSDGPGPSSTTTSSIC
TDAVVHRDSIPTDADFLLGMATVPHFASFRDKKLGTWFIQSLCQNLINLVPSGYDLLSIL
TKVNDDVSRKTNGIKKQMPQPAYSLRKRVVFPIPKEPPPKL
NT seq 1746 nt   +upstreamnt  +downstreamnt
atggatttccaaaggctgctgttgcaggtggaacaagccctgagcagtgaagaagtacaa
gcacttgcatttctttgcaaagatttactggataaagacctgaactcagtgaccacagct
agtaaactcttctctcttctgatggaccaagaactgttatcccctgatcaaccttacttg
cttgctgacctactactcaccatccagcggaacagcttgatgcgaggccttggcctcaac
aaccagctaccaacaaccagtagcctcatctctccttatagaaagctgctgtataacctg
tcagagaacatcactacagatgagttgagggagatcaagttcttgttgagtaatgaactc
cctcgtagaaaactagaggacaacctgactaccttgcaattattcctggaaatggagaaa
attgatattttgagcatcataaaactaaacactcttgaaagcatttttggaattgtctgc
cccatgttgaaaacaacaatcaaaaagtataagacgcagaattccttagctgggccagga
actcaagagacaggggtgggacagttcagaccaagatctgtgtctgtgtctgtgtctgaa
gctcatccaggaatccaggctgcctccatgcttccaaagagaactgtcttttgtgaacta
tcagttgaacagtatagccattctgacgagactctcattccccccacttacttctcgagt
tcacagccttcagccaaggtatcctgtctgaatcgatctgacacctctctggcagatgtt
cggagagtctcatattcgatggatgcagtactttcacatgggctgagtctcctaagtacc
aatggggacaactgtgctgctctcattaaagagtatcatcatgtttcatccacatcctca
tgtggagacaataagaactttggcccagcagatcctcagacaggaaacaccaaaagagag
gaactgggagaatattctatgacaggaaaaaagagaggtttctgtctgatcattaacaac
aatgactttagaaattcccctcaactgttaaaagaaagagagggaacacacattgacaaa
aagagtttggtgagtgtgtttaactggctgggctttgagacacagactgagccagactgc
agtcgggagaagatactatctctacttgtggagctgagcaaacgggatcacagccagatg
gactgcctggtgtgctgcgttctgagccacggcctagagggaggtgtttacggggtggac
gggctagaggtcagtgtcagggagctcacaaagcccttctctggactggagtgcagctca
ctgagggacaagcccaagctgttcttcattcaggcctgtcagggcaacaaggaccaaaag
caagtgttcatccagtctgatggcccaggaccaagctctactaccaccagctctatctgc
actgatgcagtggtacacagagactccattcccactgatgctgacttccttctgggcatg
gccactgtccctcactttgcctcttttagagacaagaagctgggcacttggttcatccag
tcgttgtgccagaacctcatcaacttggtgcccagtgggtatgacttgctgtccatcctg
accaaggtgaatgatgatgtcagcaggaagaccaatggcattaagaagcagatgccccag
cctgcatactcactcagaaagagggtggtctttcccattcccaaagaaccacctcccaaa
ctgtga

DBGET integrated database retrieval system