KEGG   Salmo salar (Atlantic salmon): 106569579Help
Entry
106569579         CDS       T04363                                 

Gene name
lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03030  DNA replication
sasa03410  Base excision repair
sasa03420  Nucleotide excision repair
sasa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106569579 (lig1)
   03410 Base excision repair
    106569579 (lig1)
   03420 Nucleotide excision repair
    106569579 (lig1)
   03430 Mismatch repair
    106569579 (lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106569579 (lig1)
   03400 DNA repair and recombination proteins [BR:sasa03400]
    106569579 (lig1)
Enzymes [BR:sasa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106569579 (lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     106569579 (lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106569579 (lig1)
DNA replication proteins [BR:sasa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106569579 (lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106569579 (lig1)
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106569579 (lig1)
   NER (nucleotide excision repair)
    Other NER factors
     106569579 (lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     106569579 (lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 106569579
NCBI-ProteinID: XP_013996548
UniProt: A0A1S3M043
LinkDB All DBs
Position
ssa14
AA seq 1088 aa AA seqDB search
MQRSISSFFQPKTGKEKESKKCDGPVKDKPVKDKPEPVKRPLKVQNGVHKEPDSPVKKFT
KRSRQILDSDDDDEAQAPAGIEQEQEDKAVQPKDEVFKAVTTPLSPASPVTPAASATPVT
PSATPVTPAASPTPGTPDTPTSISPSGIPKRRTARKQFPKRKLDSRSGSEKEEEEQGPQN
KRAKVEETQDSTENEEETMDVGGENSVDKPEVAQNNPEEKETDEEKTKDGEKEKALDVKE
TATEKAEEEKGKSEKAKERSPKGQKVKERSPKERSPKGQKVKERSPKERSPKSQKVKERS
PKERSPKGQKVKERSPKERSPKGQKVKERSPKERSPKGQKVVKDDKEKGSPKNERKAVKE
GKDLKEEKVSECPQATKAPTISSFFAPRKAAVKMERPEKSEGDGKEKSGECIKEEATVSR
TTEDVKDKKGEKTAQAQYDPSRPNYHPVDHACWRQGERVPYLAVARTFEKIEEDSGRLRN
IETLSNLLRSVIVLSPEDLLCCVYLCLNQLGPAYMGLELGVGETVLMKAVAQATGRQLDK
IKAEAAEKGDLGLVAESSRNNQRIMFQPANLIAGGVFNKLKDIGNMSGNSAMNKKIDIIK
GLFVACRFSEARYIVRSLAGKLRIGLAEQSVLSALSQAVCLTPPGQDFPPAVIDAGKGMS
AEKQKAWIEEKSLILKQTYCEMPNYDVIIPVILKEGIDQLPNHCKLTPGVPLRPMLAHPT
KGVGEVMKRFDEAAFTCEYKYDGERAQIHILENGEVRIFSRNQEDNTTKYPDIISRIPTV
KNESVVSCVLDSEAVAWDREKKQIQPFQVLTTRKRKDVAAADIKVQVCVYAFDLLYLNGE
SLVKQSLSCRRALLKESFQEKEGEFVFARAIDSDNTDAIAEFLEQSVRDSCEGLMVKTLE
KDATYEIAKRSHNWLKLKKDYLDGVGDTIDLCVIGAYLGKGKRTGTYGGFLLACYDEDNE
EFQSVCKIGTGFKDEDLEQHYKFLKEHILPKPRPYYRVDQSTEPDLWLDAVQVWEVKCAD
LSLSPIYKAGMGLCDPEKGISLRFPRFLRIRDDKKPEEATSGGQIADLYRKQQVVQNQGD
KADLEDYY
NT seq 3267 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatatcatctttctttcagcccaaaacgggcaaagagaaggagagcaaa
aaatgtgatggcccggtgaaagacaagccggtgaaagacaagccagaaccagtcaaaagg
cctctcaaagttcagaatggggtccataaagagcctgattcgccagtaaagaagttcact
aaacgcagtcgtcagatcttggacagtgatgatgatgatgaggctcaggctccagccgga
atagaacaggagcaagaggacaaggctgtgcaacccaaggatgaagtattcaaggctgtt
accacccccctgtcccccgcatctccagtgaccccagcagcatccgccactccagtgacc
ccatccgccactccagtgaccccagccgcctcccccacccctggaaccccagacaccccc
acttccatctcaccctccggaatacccaaacgccgcaccgcacggaagcagttccccaag
agaaagctggacagcaggagtggcagtgaaaaggaagaggaagaacaaggaccgcagaat
aaaagagcaaaggttgaggagacacaggacagcaccgagaatgaagaggaaacgatggat
gtgggaggagagaacagtgtggataagcctgaggtggcgcagaacaacccagaggagaaa
gagacagatgaagagaagaccaaagatggagagaaggagaaagcacttgatgtgaaagag
actgcgactgagaaggctgaggaggaaaaaggaaaaagtgaaaaggctaaagagagaagt
cctaagggtcaaaaagttaaagagagaagtcctaaagagagaagtcctaagggtcaaaag
gttaaagagagaagtcctaaagagagaagtcctaagagtcaaaaggttaaagagagaagt
cctaaagagagaagtcctaagggtcaaaaggttaaagagagaagtcctaaagagagaagt
cctaagggtcaaaaggttaaagagagaagtcctaaagagagaagtcctaagggtcaaaag
gtggtaaaggatgacaaagaaaaaggaagtcctaaaaatgaaaggaaggcagtgaaggag
gggaaagacttgaaagaagagaaagtgtcagaatgcccccaagccacaaaagcccccacc
atcagcagtttctttgctcccaggaaggctgctgtaaagatggagagaccagagaagagc
gagggagacggaaaggagaagagcggggagtgtataaaggaagaggcgacggtgtcccgt
accacggaggatgttaaagacaagaaaggagagaagactgcccaggcccagtatgacccg
tccagacccaactaccacccagtagaccacgcctgctggaggcagggagagagggtcccg
tatttggctgttgcacgcacctttgaaaagattgaggaagattctggcagattgaggaac
attgaaacattatcaaatctcctacgctctgttatcgtcctctctccagaggacctgctg
tgctgcgtctacctgtgtctcaatcagctgggtcctgcttacatggggctggagctggga
gtgggagaaactgttcttatgaaggctgtcgcacaagctactgggcgacagttggacaaa
atcaaggcggaggctgcggagaagggagacttgggtttggtggctgagagttcccgtaac
aaccagagaattatgttccagccagccaatctgattgcggggggtgtgttcaacaaactg
aaagacatcgggaacatgagtgggaattctgccatgaataagaagattgacatcatcaaa
ggtctctttgtagcatgtcgtttctctgaagccagatacattgtcaggtcgctggcaggg
aagctgaggattggcttggctgaacagagtgtactgtctgccctgagtcaggccgtgtgt
ctgactcctccaggacaagacttccctccggcggtgattgacgcggggaaaggaatgagt
gcagaaaaacagaaagcttggatagaagagaagagccttatcctcaaacagacttactgt
gagatgccaaactatgatgtcatcatcccagtcattctgaaggaggggattgaccaactc
cccaaccactgcaaactcactccaggtgtaccgttgaggcccatgctggctcaccccacc
aaaggtgtaggagaggtgatgaagagatttgatgaagccgccttcacctgcgagtacaag
tatgatggagaacgagcacagatccatatcttggagaacggggaagtgcgtattttcagt
cgcaaccaggaggataataccaccaaatatcctgacatcatctctcgcattcctacggta
aagaatgagtctgtggtatcctgtgtgttggactctgaggcagtagcttgggacagagag
aagaaacagatccaaccattccaggttctcaccacacggaagagaaaggatgtggctgca
gctgatatcaaggtccaagtgtgtgtgtacgccttcgacctgctttatctcaatggagag
tctctagtgaagcagtccttgtcatgtcgcagggctctgttgaaggagagcttccaggag
aaggagggagagtttgtgttcgcccgtgccatcgactcagacaacacagacgccatcgct
gagttcctggagcaatcggttcgagactcctgtgagggactcatggtgaagactctggag
aaagatgccacctatgaaatcgccaagcgctctcacaactggctcaagctgaagaaggat
tatctggatggcgtgggggacacgattgatctgtgtgtgatcggagcgtatctggggaag
gggaagagaacagggacctatggaggctttctgctcgcctgctacgatgaggacaatgaa
gagttccagtcagtctgcaagattgggacaggtttcaaggatgaagatttggagcaacat
tacaaattcttaaaggagcatattttgccaaagccccgcccctattaccgtgtggaccaa
tcaactgagcccgacttgtggctcgatgccgtgcaagtatgggaagtgaagtgtgccgac
ctatcgctgtcgccgatctacaaggctggcatgggattgtgtgacccagagaagggcatt
tctcttcggttcccacgcttcctgaggatcagagatgataaaaagccagaggaggccact
tcaggaggacagattgctgatttatacaggaagcagcaggttgttcagaatcagggcgac
aaagctgaccttgaggactactactga

DBGET integrated database retrieval system