KEGG   Salmo salar (Atlantic salmon): 106569638
Entry
106569638         CDS       T04363                                 

Definition
(RefSeq) cullin-3-like
  KO
K03869  cullin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106569638
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106569638
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     106569638
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106569638
SSDB
Motif
Pfam: Cullin Plasmodium_HRP
Other DBs
NCBI-GeneID: 106569638
NCBI-ProteinID: XP_013996667
UniProt: A0A1S3M0F8
LinkDB
Position
ssa14
AA seq 595 aa
MSNLKGGVKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLVNKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLEGRSVYEEDFESPFLEMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVLHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDRFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQHLQSTGVRLIHPHTPLTVHTPPPTVHIVITPPNSPHCHHPPNSPHCHHPPNSP
HCHHPPNSPHCHHPPNSPHCQHLPPIQSTLSTPPPITVHIVNTSPITVHIVNTPP
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgtccaacctcaaaggcggcgtcaagaaggacaccaagatgaggataagagcctttcct
atgacaatggatgagaagtatgtcaacaatatctgggaccttctgaagaacgctatccag
gagatccagaggaagaacaacagcgggctgagcttcgaggagctctacaggaacgcctac
acaatggtgctgcacaaacatggcgagaagctctacacgggcctgcgcgaggtcgtcact
gagcacctcgtcaacaaagtacgggaagatgtcctaaactcgttaaacaataactttctg
cagactttgaatcaagcgtggaacgaccaccagacagcgatggtcatgatcagagacatc
ctgatgtacatggaccgggtgtacgtgcagcaaaacaacgtggagaacgtctacaacctg
ggcctgatcatcttcagagaccaggtggtacgctacggctgcatccgagaccacctgcga
cagaccctgctggacatgatcgcacgggagaggaaaggagaggtggtggacaggggagcg
atcaggaacgcctgtcagatgctgatgattctgggtctggagggtaggtctgtgtacgag
gaagactttgagtcccccttcttagaaatgtctgcagaattcttccagatggagagccag
aagttcctagcggagaacagtgccagtgtttacatcaagaaggtggaggccaggatcaac
gaggagatagagcgggtgctgcactgcctggacaagtccacagaggagcccatcgtcaag
gtggtggaacgggagctcatctccaaacacatgaagaccatcgtggagatggagaattct
ggccttgttcacatgctcaagaacggcaagacagaagacctgggctgtatgtacaagctg
ttcagccgtgtgcctaatggcctgaagaccatgtgtgagtgtatgagctcctacctgagg
gagcagggcaaggctctggtgtcagaggagggagagggcaagaaccctgtcgactacatt
cagggcctgttggacctgaagacgcggttcgaccgtttcctcctggagtcgttcaacaac
gaccggctcttcaagcagaccatcgccggagactttgagtacttcctcaacctcaactcc
cgctccccagagtacctctccctcttcatcgacgacaagctcaagaagggagtcaaaggg
ctgacagaacaggaggtggagtccatcttggacaaggccatggttctattccggttcatg
caggagaaggatgtgtttgagagatactacaaacagcacctggcccggaggctgctcacc
aacaagagtgtctcggacgactctgaaaagaacatgatctctaagttgaagactgagtgt
ggctgtcagttcacctctaaactggaagggatgttcagagacatgagcatctccaacacc
accatggacgagttcagacaacacctacagtccacgggggtaagacttatacatccacac
acacccctaacagtccacacaccccccccaacagtccacattgtcatcaccccccccaac
agtccacattgtcatcacccccccaacagtccacattgtcatcacccccccaacagtcca
cattgtcatcacccccccaacagtccacattgtcatcacccccccaacagtccacattgt
caacacctcccccccatacagtccacattgtcaacacctccccccattacagtccacatt
gtcaacacctcccccattacagtccacattgtcaacacccccccc

KEGG   Salmo salar (Atlantic salmon): 106580681
Entry
106580681         CDS       T04363                                 

Definition
(RefSeq) cullin-3
  KO
K03869  cullin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106580681
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106580681
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     106580681
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106580681
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 106580681
NCBI-ProteinID: XP_014017475
UniProt: A0A1S3NQF9
LinkDB
Position
ssa20
AA seq 767 aa
MSNLSKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNA
YTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRD
ILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRG
AIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARI
NEEIERVLHCLDKTTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLACMYK
LFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLQESFN
NDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRF
MQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISN
TTMDEFRQHLQSTAVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPSPRHAFEVFRRFYLA
KHSGRQLTLQHHMGSADLNATFYGPIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTI
LMLFNNREKSMFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTV
NDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNV
LVAEVTQQLRSRFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtccaatctgagcaaaggcggcaccaaaaaggacaccaagatgagaatacgagccttt
cctatgacgatggacgaaaagtatgtcaacaacatctgggaccttctgaagaatgccatc
caggagatccagaggaagaacaacagcgggctgagcttcgaggagctctacaggaacgcc
tacaccatggtgctgcacaaacacggcgagaagctctacacgggcctccgggaggtggtc
accgagcaccttatcaacaaagtacgggaagatgtcctcaactcactaaacaacaacttc
ctccaaacactgaaccaagcctggaacgaccaccagacggccatggtcatgatcagagac
atcctcatgtacatggaccgggtgtacgtgcagcagaacaacgtggagaatgtctacaac
ctgggcctgatcatcttcagggaccaggtggtgcgctacggctgcatccgagaccacctc
cgacagaccctcctggacatgatcgcacgagagaggaagggcgaggtggtggacaggggg
gcgatcagaaatgcatgccagatgttaatgatcttaggccttgaagggaggtcggtttac
gaagaggactttgaggccccgtttttagaaatgtctgcagagttcttccagatggaaagt
caaaagtttttggcagagaacagcgcgagcgtgtacataaagaaagtggaggcacggata
aacgaggagattgagcgcgtgctgcactgcctggacaagacgacggaggagcccatcgtc
aaggtggtggagcgggagctcatctccaagcacatgaagaccatcgtggaaatggagaac
tcgggcctcgtccacatgctcaagaacggaaagacagaggacctggcgtgtatgtataag
ctctttagcagagtgccaaacggactgaagacaatgtgtgagtgcatgagctcctacctc
cgcgagcagggcaaggcgctggtgtcagaggagggcgagggcaaaaaccctgtagattac
atccagggactgttggatctgaagtcacgtttcgaccgcttcctccaagagtcgttcaac
aacgaccggctcttcaagcagacaatcgcaggggactttgaatacttcctcaacctcaac
tcgcgctcccccgagtacctctccttgttcatcgatgacaagctgaagaaaggcgtaaaa
ggattgacggagcaagaggtggagtcgatcctggataaggccatggtgctcttcaggttc
atgcaggagaaggatgtgtttgagcggtactacaaacagcacctggccaggaggctgctc
accaacaagagtgtctcggacgactcggagaagaacatgatctctaagctcaagacggag
tgtggttgccagttcacctctaaactggaaggcatgttccgggacatgagcatctcaaac
acaaccatggacgagttccgccaacacctacagtcaacagcggtgtcgttgggcggagtt
gatctcacagtgagggtcttgacgacaggttactggccaacgcagtccgccacgcccaaa
tgtaatatccccccttctcctcgacatgcatttgaagtctttagaaggttttatctggcc
aagcacagcggcaggcagcttacgttgcagcatcacatgggctctgcagacctcaacgcc
accttctacggcccaatcaaaaaggaggacggctcagaggtgggggtgggcggcgcccag
gtaacgggctccaacaccaggaagcacatactgcaggtgtccaccttccagatgacaata
ctaatgctcttcaacaaccgggagaagtccatgtttgaggagatccagcaggagacagac
atcccggagagggagctggtgcgagcgctgcagtcactggcctgcgggaagcccacccaa
cgcgtcctcaccaaggagcccaagtccaaggagatcgagaacggccacgtgttcaccgtt
aatgaccagttcacctccaagctgcaccgcgtcaagatccagacagtcgctgctaagcaa
ggagagtcggacccggagaggaaggagacgcggcagaaagtggacgacgacaggaagcac
gagattgaggcggccatcgtccgcatcatgaagtctagaaagaagatgcagcataacgta
ctagtagcagaggtcacccagcagctgcgatcgcgattcctccccagtcctgtagtcatc
aagaagcgcattgaaggactcattgagcgggaatatttggcgcggacaccagaggatcgc
aaagtgtacacttatgtagcataa

KEGG   Salmo salar (Atlantic salmon): 106600593
Entry
106600593         CDS       T04363                                 

Definition
(RefSeq) cullin-3-like
  KO
K03869  cullin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106600593
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106600593
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     106600593
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106600593
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 Phage_antitermQ
Other DBs
NCBI-GeneID: 106600593
NCBI-ProteinID: XP_014047544
UniProt: A0A1S3R721
LinkDB
Position
ssa03
AA seq 766 aa
MSNLKGGVKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAY
TMVLHKHGEKLYTGLREVVTEHLVNKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDI
LMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGA
IRNACQMLMILGLEGRTVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARIN
EEIERVLHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKL
FSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKTRFDRFLLESFNN
DRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVESILDKAMVLFRFM
QEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNT
TMDEFRQHLQSTGVSLGGVDLTVRVLTTGYWPTQSATPKCTIPPSPRHAFEVFRRFYLAK
HSGRQLTLQHHMGSADLNATFHGLIKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTIL
MLFNNREKSTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHVFTVN
DQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVL
VAEVTQQLRARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgtccaacctcaaaggcggcgtcaagaaagacaccaagatgaggataagagcctttcct
atgacaatggatgagaagtatgtcaacaacatctgggaccttctgaagaatgccatccag
gagatccagaggaagaacaacagcgggctgagcttcgaggagctctacaggaacgcctac
acaatggtgctgcacaaacacggcgagaagctctacacaggcctgcgtgaggtcgtcacc
gagcacctcgtcaacaaagtacgagaagatgtcctcaactcattaaacaataacttcctg
cagacattaaatcaagcttggaatgatcaccagacggcaatggtcatgatccgagacatc
ctcatgtacatggaccgggtttacgtgcagcagaacaacgtggagaatgtgtacaacctg
ggcctgatcatcttcagagaccaggtggtgcgctacggctgcatccgagaccacctccgc
cagaccctgctggacatgatcgcacgtgagaggaagggagaggtggttgataggggagcg
atcaggaacgcctgtcagatgctgatgattctcggcctggagggcaggactgtgtacgag
gaagactttgaggcccccttcttagaaatgtctgcagaattcttccagatggagagccag
aagttcctagcggagaacagtgccagtgtgtacatcaaaaaggtggaggccaggatcaac
gaggagatagagcgggtgctgcactgcctggataaatccacagaggagcccattgtcaag
gtggtggagcgggagctcatctccaaacacatgaagaccatcgtggagatggagaactct
ggcctggtccacatgctcaagaacggcaagaccgaagacctgggctgcatgtacaagctg
tttagccgtgtgcctaacggcctgaagactatgtgtgagtgtatgagctcctacctgagg
gagcagggcaaggctctggtgtcagaggagggagagggcaagaaccctgtcgactacatc
cagggcctgttggacctgaagacgcggtttgaccgcttcctcctggagtcgttcaacaac
gaccggctcttcaaacagaccatcgcaggagactttgagtacttcctcaacctaaactcc
cgctcccccgagtacctctccctcttcatcgacgacaagctcaaaaagggagtcaaaggg
ctgacagagcaggaggtggagtcaatcctggacaaggccatggtgcttttccggttcatg
caggagaaggatgtgtttgagaggtactacaaacagcacctggcccggaggctgctcacc
aacaagagtgtctccgacgactctgagaagaacatgatctctaagctgaagactgagtgt
ggctgtcagttcacctctaaactggaagggatgttcagagacatgagcatctccaacacc
accatggacgagttcagacaacacttacagtccacgggggtgtctctagggggcgtcgac
ctcaccgtaagagtactcaccactggctattggcccacgcagtcggccacgcccaagtgc
accatccccccctcccccagacatgcctttgaggtctttagaaggttctacttggccaaa
cacagcggcagacagttgacactccagcaccacatgggctcagcagacctcaacgccacc
tttcacggtctcatcaagaaggaggatggttcggaggtaggagtgggaggagcacaggtg
acaggctcgaacaccaggaaacacatactgcaggtctctactttccagatgaccatcctc
atgctcttcaacaacagagaaaagtccaccttcgaggagatccagcaggagacggacatc
ccggagagggagctggtgcgagcgctgcagtcgctggcctgtggcaagccaacccagcgc
gtcctcaccaaggagcccaagtccaaggagatcgagaacggccacgtgtttacagtcaac
gatcagtttacctccaagctgcacagagtcaaaatacagacagtcgctgctaagcagggg
gagtctgaccctgagagaaaagagacgcggcagaaggtagacgacgacaggaagcacgaa
attgaagcagccatcgtccgcatcatgaagtccaggaagaagatgcagcacaacgtcctg
gtagcagaggtaacccagcagctgcgggcccggttcctccccagccccgtggtcattaag
aagcgcattgaaggacttatagagagagaatacttggcacggacacccgaggaccgtaaa
gtctacacctacgttgcataa

KEGG   Salmo salar (Atlantic salmon): 106612448
Entry
106612448         CDS       T04363                                 

Definition
(RefSeq) cullin-3-like
  KO
K03869  cullin 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106612448
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106612448
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     106612448
DNA repair and recombination proteins [BR:sasa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     106612448
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 RhgB_N Phage_antitermQ
Other DBs
NCBI-GeneID: 106612448
NCBI-ProteinID: XP_014069052
UniProt: A0A1S3SXI2
LinkDB
Position
ssa09
AA seq 791 aa
MSNLSKGGTKKDTKMRIRAFPMTMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNA
YTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRD
ILMYMCHLVTLPWTGNALLPGCRSQTRSGDRVYVQQNNVENVYNLGLIIFRDQVVRYGCI
RDHLRQTLLDMIARERKGEVVDRGAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFF
QMESQKFLAENSASVYIKKVEARINEEIERVLHCLDKTTEEPIVKVVERELISKHMKTIV
EMENSGLVHMLKNGKTEDLACMYKLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKN
PVDYIQGLLDLKSRFDRFLLESFNNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLK
KGVKGLTEQEVESILDKAMVLFRFMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISK
LKTECGCQFTSKLEGMFRDMSISNTTMDEFRQHLQSTAVSLGGVDLTVRVLTTGYWPTQS
ATPKCNIPPSPRHAFEVFRRFYLAKHSGRQLTLQHHMGSADLNATFYGPIKKEDGLEVGV
GGAQVTGSNTRKHILQVSTFQMTILMLFNNREKSMFEEIQQETDIPERELVRALQSLACG
KPTQRVLTKEPKSKEIENGHVFTVNDQFTSKLHRVKIQTVAAKQGETDPERKETRQKVDD
DRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLRSRFLPSPVVIKKRIEGLIEREYLART
PEDRKVYTYVA
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgtccaatctcagcaaaggcggcacaaaaaaggacaccaagatgaggatacgagctttt
cctatgacaatggacgagaagtatgtaaacaacatctgggaccttctgaagaatgccatc
caggagatccagaggaagaacaacagcgggctgagcttcgaggagctctacaggaacgcc
tacaccatggtgctgcacaaacacggcgagaagctctacacgggcctccgggaggtggtc
acagagcacctcatcaacaaagtacgggaagatgtcctcaactcactaaacaacaacttc
ctccaaacactaaaccaagcctggaacgaccaccagacagccatggtcatgatcagagac
atcctcatgtacatgtgtcatctcgtaaccctcccttggactggtaatgcattgcttcct
ggctgcaggtctcaaacgcgctccggggaccgggtgtacgtgcagcagaacaatgtggag
aacgtctacaacctgggcctgatcatcttcagagaccaggtggtgcgctacggctgcatc
cgagaccacctccgacagaccctcctggacatgatcgcacgagagaggaagggcgaagtg
gtggacaggggggcgatcagaaatgcctgccagatgttaatgatcttaggcctcgaaggg
aggtcggtttacgaagaggactttgaggccccgtttttagaaatgtctgcagagttcttc
cagatggaaagtcaaaagtttttggcggagaacagcgcaagcgtgtacataaagaaagtg
gaggcgcggataaacgaggagattgagcgagtgctgcactgcctggacaagacgacggaa
gagcccatcgtcaaggtggtggagcgggagctcatctccaagcacatgaagaccatcgtg
gaaatggagaactcgggccttgtccacatgctcaagaacggaaagacagaggacctggcg
tgtatgtataagctctttagcagagtgccaaacggactgaagaccatgtgtgagtgcatg
agctcctacctccgcgagcagggcaaggcgctggtgtcagaggagggcgagggcaaaaac
cctgtggattacatccagggtctgttggatctgaagtcgcgtttcgaccgcttccttcta
gagtcgttcaacaacgaccggctcttcaagcagaccatcgcaggggactttgaatacttc
ctcaacctcaactcgcgctcccccgagtacctctccttgttcatcgacgacaagctgaag
aaaggcgtaaaaggattgacggagcaggaggtggagtcgatcctggacaaggccatggtg
ctcttcaggttcatgcaggagaaggatgtgtttgagaggtactacaaacagcacctggcc
aggaggctgctcaccaacaagagcgtctcggacgactcggagaagaacatgatctctaag
ctcaagacggagtgtggttgccagttcacctccaaactggaaggcatgttccgagacatg
agcatctcaaacacaaccatggacgagttccgccaacatctacagtcaacggcggtgtcg
ttgggtggagtcgatctcacagtgagagttttgacgaccggttactggccaacgcagtcc
gccacacccaaatgtaatatccccccttctcctcgacatgcatttgaagtctttagaaga
ttttatctggcaaaacacagcggcaggcagctcacgttgcagcatcacatgggttctgca
gacctcaacgccaccttctacggcccaatcaaaaaggaggacggcttggaggtgggggtg
ggcggcgcccaagtaacaggctccaacaccaggaagcacatactgcaggtgtccaccttc
cagatgacaatacttatgctcttcaacaaccgggagaagtccatgtttgaggagatccag
caggagacagacatcccggagagggagctagtgcgagcgctgcagtcgctggcctgcggg
aagcccacccagcgggtcctcaccaaggagcccaagtcgaaggagatcgagaacggtcat
gtgttcaccgtcaacgaccagttcacctccaagctgcaccgcgtcaaaatccagacagtc
gccgctaagcaaggagagacggacccggagaggaaggagacgcggcagaaagtggacgat
gataggaagcatgagatcgaggcggccatcgtccgcatcatgaagtctagaaagaagatg
cagcataacgtgttggtagcagaggtcacccagcaattgcgatcgcgattcctccccagt
cctgtagtcatcaagaagcgcattgaaggactcattgagcgggaatatttggcacggaca
ccggaggatcgcaaagtgtacacttatgtagcataa

DBGET integrated database retrieval system