KEGG   Salmo salar (Atlantic salmon): 106569944
Entry
106569944         CDS       T04363                                 

Gene name
ATF6
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106569944 (ATF6)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106569944 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106569944 (ATF6)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106569944 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA bZIP_Maf MCU DUF724 DUF4140 CENP-H
Other DBs
NCBI-GeneID: 106569944
NCBI-ProteinID: XP_013997192
UniProt: A0A1S3M1V7
LinkDB
Position
ssa14
AA seq 703 aa
MTTDLLSDLDSRFFADNLLTSDDWDACLYQCESMEEGEDGEYTRGPKYETSFDNDLVLTL
DPDNPTSPWRHLDDNLLTGDCPVLKDKMTITQPLPVDMLFRVKAEPPSPASSLASDCSLT
SLPDSQITVKGENPPTPPYMFGDVLSPPLGTCEVTVASAPQAQPHLLPQPQQHQTAANNG
IDAQATVQPTAATIKASTILSSKPPIQPRPVCLAALPLPQAPSPAKALILHSLPSMDHSR
PVVLSQSVCLGSTPAIVKMEPVSPTMPHGHSPTAPFPSKPIVPASSLPGSNGIDVSVCQS
HVSQSMKVMKRQQRMIKNRESACQSRKKKKEYLQNLEGQLREAQQENERLRRENQALRER
LVGKEGSESGNNKRAVCIMAVLLFMTFSFGPVSITDRKLETGLQEEVVPHTGRRLLEFET
AQGHSRVEERMDPEEEEGEDGWKGGEVERESTDSYQFRNLSDVFSDVKDLVLQDIDRYFT
SNDCRQFNRSESLRLADELRGWVHRHQIDRKKSGGKPKMVKKAKIAQKAQLRKTNFSRYL
PIQTHRSIESQIQVLPAGPEISYSDFMDAIDRREDTFYVVSFRRDHLLLPAISHNKTTRP
KMSLVMPAMSVNESLYNKSQGYEMMMQVDCEVMDTRIIPIKASAVPPSLRDPPPAPPAHH
HHSNHTSLRGRHHPHAGGAESPRQPLPVRRREAEYYISQGGQV
NT seq 2112 nt   +upstreamnt  +downstreamnt
atgactacggatttactatctgatttggatagtcgtttcttcgctgataatcttctgaca
agcgacgattgggatgcctgtctgtaccagtgtgagagcatggaggagggagaggacggg
gagtacacgagaggaccgaaatatgaaacatcgtttgacaacgatctcgtgctgactctt
gatcccgacaatcccacgtcgccgtggcgacacctggacgacaaccttctcacaggggac
tgtcccgtattgaaagataaaatgacgataacgcagcctttgccagtggacatgttgttc
cgggtgaaggcggagcctccctcccctgcctcctcgctggcctcagactgctccctgacg
tcactcccagactcacagatcacagtgaaaggggagaacccgcccacacctccttatatg
tttggagatgtgctgtcgccaccacttggcacatgtgaagtcacggtggcctccgcgccg
caggcccaaccacatttgctcccacagccacagcaacaccaaacagcagccaacaatggc
atcgacgcacaggccacagtccagcccactgcggccaccatcaaagccagtaccatcctg
agcagtaagcctcccatccagcccaggcctgtgtgtttagcggctctccccctcccccag
gctcccagtccagccaaggccctcatactgcacagcctgcctagcatggaccacagcagg
cctgtggtgctttcccagtctgtctgtctggggtccactccagccatcgtcaaaatggag
cctgtctctcccaccatgcctcacggccatagccccacagccccattccccagcaaaccc
atagtcccagcgtcctctctgccagggagcaatggcattgatgtgagtgtctgtcagtca
cacgtcagtcagtcaatgaaggtgatgaagaggcagcagaggatgatcaagaaccgggag
tcggcgtgccagtcacgcaagaagaagaaggagtacctgcagaacctggagggccagctg
agggaggcgcagcaggagaacgagcgcctccgcagggagaaccaggccctgagggagagg
cttgtcgggaaagagggcagtgagtctggtaacaataagagggccgtctgcatcatggca
gtgctactattcatgaccttcagtttcggccctgtcagtatcacagacaggaagctggag
acgggattacaggaggaggtggtgcctcacacaggaagacgtctcctggagtttgagacg
gctcagggacacagcagagtggaggaaaggatggatcctgaggaggaggagggagaggat
gggtggaagggaggagaggtggagagggaatccaccgattcataccagtttaggaacctg
agtgacgtgttcagcgacgtgaaggatttggtcctgcaggacatcgaccgctatttcacc
tccaatgactgcaggcagttcaaccgttccgagtccctcaggctggcggacgagctgaga
ggatgggttcacaggcaccagatcgacaggaagaagtctggagggaagccaaagatggtg
aaaaaagctaaaatagcgcagaaagcacagctaaggaagacaaacttctccagatacctt
cccatacagacccatcgttccatcgagagtcagatacaagtgttacctgccggtcccgag
atcagctatagtgacttcatggacgccatcgaccggcgtgaggacaccttctacgtggtc
tccttcagacgggatcacctgctgttgcctgccatcagccacaacaagaccacacggccc
aaaatgtctctggtgatgccggctatgtctgtcaacgagagtttatataacaaatcccag
gggtatgagatgatgatgcaggtggattgtgaggtcatggacacccggatcatccccatc
aaagcctccgctgttcccccgtccctccgcgacccccctcctgctccccccgcccaccat
caccacagcaaccacacctccctccgaggccgccaccatccccacgccggcggagcggag
tctccacggcaacccttacctgtcagaagacgggaggccgagtattacatcagccagggg
ggccaggtttga

DBGET integrated database retrieval system