KEGG   Salmo salar (Atlantic salmon): 106570380Help
Entry
106570380         CDS       T04363                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00020  Citrate cycle (TCA cycle)
sasa00190  Oxidative phosphorylation
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sasa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sasa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106570380
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106570380
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106570380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 106570380
NCBI-ProteinID: XP_013998118
UniProt: A0A1S3M4E4
LinkDB All DBs
Position
ssa14
AA seq 661 aa AA seqDB search
MALVCTTSRVLTKNILSAKALLAVSQSSRKLHFSIYGKNKAKVSDGISTQYPVVDHEFDA
VVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEGDDWRWHFY
DTVKGSDWLGDQDAIHYMTEQAPHAVVELENFGMPFSRTEDGKIYQRAFGGQSLKFGKGG
QAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEEGECKGVIALCMEDGSI
HRFRSKNTVIATGGYGRTYFSCTSAHTSTGDGNAMVTRAGLPCQDLEFVQFHPTGIYGAG
CLITEGCRGEGGILINSEGERFMERYAPNAKDLASRDVVSRSITIEIREGRGCGPEKDHA
YLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQVITY
TPEEGDKVVPGLFACGEAACASVHGANRLGANSLLDLVVFGRACAHTIADICNPGEKLSP
LKPNAGEESVANLDKLRFANGSMRTSEIRLNMQKTMQNHAAVFRTGKVLKEGCDKMDAVY
QTLDDIKTFDRGIVWNTDLVETLELQNLMLNAVQTINSAEQRQESRGAHSREDFKDRMDE
LDYAKPLAGQVRKPIEEHWRKHTMSTVDPKTGKVTLKYRPVIDNSLDAEDCAAIPPAIRS
Y
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggccttggtgtgtactacctcccgtgttctcaccaaaaacatcctgtcagctaaggcg
cttctggcagtatcccagagctccaggaagctccacttctccatctacgggaagaacaag
gctaaagtgtcagatggcatctccacacagtaccccgtggtagaccatgagtttgatgcc
gtggttgtgggtgccggtggggcaggactacgtgctgcttttggcctgtctgaggctggc
ttcaacacagcttgtgtcacaaagctgttccccaccaggtcgcacacggtggctgcacag
ggtgggatcaacgctgcccttggaaacatggagggagatgattggaggtggcatttctac
gacacagtgaagggatctgattggctgggagaccaggatgccatccactacatgacagag
caggccccacatgccgttgtggagctagagaactttggcatgcccttcagccgtaccgag
gatggcaagatctaccagagggcttttggtggccagagtctgaagtttggcaagggaggc
caggcccaccggtgctgctgcgtagctgacagaaccggccactcccttctgcacacactc
tatggacggtctctgaggtatgacaccagctactttgtggagtactttgccctggatctg
ctgatggaggaaggagagtgtaaaggagtgattgctctgtgtatggaggacggatccatc
caccgcttcaggtccaagaacacagtcattgccaccggtggttacggccgtacctacttc
agctgcacgtcagcacacaccagcacaggagacggtaatgccatggtgacccgtgcaggc
ctgccctgccaagacctggaatttgtccagttccaccccacaggtatctatggagccggc
tgtctgatcacagaggggtgccgtggtgagggaggaatcctcatcaacagtgagggcgag
cgcttcatggaacgatacgcccccaacgccaaggacctggcctccagagacgtcgtgtcc
cgttccattaccatcgagatccgagagggcaggggatgtggcccagagaaggaccatgcg
tacctgcagctgcaccatctccctccacagcagctggccacccgcctgccaggcatctct
gagaccgccatgatcttcgctggcgtggatgtcaccaaagagcccatccctgtcctgccc
accgtccactacaacatgggaggaatccccaccaactacaagggacaggtcatcacctac
acgcccgaggagggtgacaaggtggtgccagggctgtttgcctgtggtgaggctgcctgt
gccagtgtccatggtgccaaccggctgggagccaactccctgctggatctggtggtgttt
ggacgtgcctgcgcccacacaatcgctgacatctgcaatcccggagagaagctctccccc
ctgaagcccaacgcaggagaggagtctgtggccaacctggacaagttgaggtttgctaac
ggcagcatgaggacctccgagatcagactgaacatgcagaagaccatgcagaaccacgcc
gctgtgttccgtaccggcaaggtcctgaaggagggatgtgacaagatggatgccgtctac
cagaccctggacgacatcaagaccttcgacagaggtattgtgtggaacactgacctggtg
gagaccctggagctgcagaacctcatgctgaacgctgtgcagaccatcaactctgccgag
cagcgccaggagagcaggggagcccactccagagaggacttcaaggaccgtatggatgag
cttgactatgccaagcctctggcgggacaggtgaggaagcccattgaagagcactggagg
aaacataccatgtccactgtggatcctaagacgggaaaggtaactctgaaatacagaccg
gttattgataactcgcttgatgcagaggactgtgctgctatccctcccgccatccgttcc
tactaa

DBGET integrated database retrieval system