KEGG   Salmo salar (Atlantic salmon): 106570401
Entry
106570401         CDS       T04363                                 

Definition
(RefSeq) focal adhesion kinase 1-like
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106570401
   04370 VEGF signaling pathway
    106570401
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106570401
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106570401
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106570401
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  FAK family
   106570401
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106570401
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 106570401
NCBI-ProteinID: XP_013998143
UniProt: A0A1S3M4G8
LinkDB
Position
ssa14
AA seq 1158 aa
MYADGYRCLSPHHSRVTCACWPFLMGEYDRHLAHSKGMATAYLDPNLNHALAGGAKSRLS
TTTERAPGAPDRVLKVFHHFESNSEHSTWASNIRHGDATDVRGIIQKILDIHKVKCVACF
GLRLSHSQSGQVHWLHPDMGVSHVREKYEQNRSQEEWRYELRIRYLPKGFLHHFSEDKPT
LNYFYQQVKNDYMVEIADQVEQDIALKLGCLEIRRFFREMRGNALDKKSNYELLEKDVGL
RRFFPKSLLDSVKAKTLRKLIQQTFKQFANMNDDQSILKFLEILAPVYRYDKECFKCALG
LSWVIQVELAIGPEEGISYLTDKGSTPTHLANFTQVQTIGYSVMEDKERKGMLQLNVAGA
AEPLTVTTPSLTTAENMADLIDGYCRLVNGVTQSFIIRPQKEGERALPSIPKVPNNEKRI
VEGVVRSAGVRAISVSDSVNSVTPTPPKPAKARRFLLPFVFCAHDSPPKEDCSGDETDDY
AEIIDEDDTYTMPSTTSLYPNRPAVSYGVDEARDYEIQRDRIELGRCIGEGQFGDVHQGV
YNSPENPTLNVAIKTCKNSTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIME
LCTMGELRSFLQVRKYNLDLSTLILFSHQLSTALAYLESKRFVHRDIAARNVLVSSTDCV
MLGDFGLSRYMEDSSYYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGI
KPFQGVKNNDVIGRIENGERLAMPHNCPPTLYSLMTKCWAYDPSKRPRFTELKTQLSTIL
EEEKAQQEERLRMEMRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHAGQLN
HYQVGYPGPHGMPAMPSGGYPPQAGVLDPHETWNHHRPGDVPMWSPNMEDGGVLDLRGLG
QVLPPHLMEERLMMQQQQMEEDQRWLEQEECFLKPESRNSRGSIDREDCSLQGPTGNQHI
YQPVGLGKPEHVAPPKKPPRPGAPSHLGSLASLNPVDSYNEGVKPWRIQPQEISPPPTAN
LDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPVLP
ASTHREIEMAQKLLNSDLAELINKMKLAQQYVLTSLQQDYKKQMLTAAHALAVDAKNLLD
VIDQARLKMIHAQSRGSH
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgtacgcagatgggtacagatgtctctctccacaccactccagggtgacatgcgcctgc
tggccctttctgatgggagaatatgacagacacctagctcacagcaaaggcatggcgaca
gcttacctggaccccaacctcaaccacgccctggctgggggggccaagtcgcgcctcagc
acgaccacggagcgggctcccggggcccctgacagagttctgaaggtcttccatcacttc
gagagtaacagcgagcatagcacatgggccagcaacatccgccatggggatgccaccgat
gtcagggggatcatccagaagatcttggacatccacaaggtgaaatgcgtggcgtgcttc
ggcctgcggctcagccactcccagtccggccaggtccactggctccaccctgatatgggc
gtgtctcacgtgagggagaagtacgagcagaaccgctcccaggaggagtggaggtatgaa
ctgcgtattcgctaccttccaaaaggattcctgcaccacttcagtgaagataaacccaca
ctcaactacttctaccagcaggtgaaaaatgactacatggtagagatagccgaccaggtc
gagcaagacattgcacttaagttgggatgccttgaaatcaggagattcttccgggagatg
cggggaaatgccctggacaagaaatcaaactatgaactattagaaaaagatgtgggctta
agaagattcttccccaagagtttactggattcagtcaaggccaaaaccctgcggaagctg
attcagcagaccttcaaacagtttgccaacatgaatgatgaccagagcatcctcaagttc
ctggagattctggcgcccgtctacagatatgataaggagtgttttaaatgtgctctcggg
ttgagctgggtcatccaagtagagctagccattggacctgaggaaggcattagctacctt
acagacaagggttcgactccaacacacctggccaacttcacccaggtgcagaccattgga
tactccgtcatggaggacaaggagaggaagggcatgctgcagctcaacgtggccggtgct
gctgagcctctcacagtgaccacgccgtcactcaccacagctgaaaatatggccgacctc
atagacggctactgtcgcctggtaaacggagtcacccagtccttcatcatacggccgcag
aaagagggagagagagcactgccttcaatccccaaggtgcccaacaatgagaagaggata
gtagagggggtggtccggagcgccggggtgcgtgccatctctgtctcagattctgtgaac
tctgtgaccccgacgcctcctaaacctgctaaagccaggcgctttctccttcctttcgtc
ttctgtgcccatgactctccgccaaaggaggattgtagtggggatgagacggacgactat
gctgagattatagacgaagacgatacctacaccatgccctcaaccacctctctttatcct
aaccgcccagcagtgagctatggagtagatgaagccagggactatgagatccagagagac
aggatagagctgggacgctgcatcggcgagggacagtttggagatgtccaccagggagtc
tacaacagcccggagaatcccactctaaacgtggccattaaaacatgcaagaacagcacg
tcggacagcgtgcgcgagaagttccttcaggaagcactgaccatgcgtcagttcgaccac
ccccacatagtgaagctgattggtgtgatcacagaaaacccagtgtggatcatcatggag
ctgtgcacgatgggagagttgaggtcatttttacaagtaaggaagtacaacctggaccta
tcaacgttgatcctgttctcccaccagctcagcacagctttggcctacctggagagcaaa
cgctttgtccatagggacattgctgccaggaacgtgctagtgtcttccacagactgtgtg
atgctgggagactttggcctctcccgctacatggaagactcctcctactacaaagcttcc
aaagggaaactgccaatcaaatggatggctccagagtccatcaacttcagacgctttacc
tcagccagcgacgtgtggatgtttggtgtgtgtatgtgggagatcctcatgtacggtatc
aagcccttccagggggtaaagaacaatgatgtcatcgggcggatagagaacggagagcgt
ctggccatgccccacaactgtccccccaccctgtacagcctgatgaccaagtgctgggcc
tacgaccccagcaagagaccccgcttcacagagctcaaaacccagctcagtactatccta
gaggaggagaaggcccagcaggaggagagactaaggatggagatgagacgtcaggtcact
gtgtcctgggactcagggggctccgacgaggccccccctaaacctagcagacctggttac
cccagccctcggtctagtgaaggattctaccccagccctcagcacgcagggcagctcaac
cattaccaggtcgggtaccctggcccccacggcatgcccgctatgcccagtggcgggtac
cctccccaggccggtgtcctggacccccatgagacctggaaccaccaccggccaggggac
gtccccatgtggtcccccaacatggaggatggaggtgtgttggacttgcgtggtttgggc
caggtgctgcccccccacctgatggaggagaggctgatgatgcagcagcagcagatggag
gaggaccagcgctggttggagcaggaggagtgcttcctgaagccagaatccaggaactcg
cggggcagcattgaccgggaggactgcagtctccaggggccgacgggaaaccaacacata
taccaaccagtgggactggggaaaccagagcatgtggcccctcctaagaagcctcctcgt
cctggagcccccagccacctgggcagtctggccagcctcaaccctgtagacagctacaac
gagggggtcaagccctggaggatccagcctcaggagatcagccctccccccacggccaac
ttggaccgctccaacgacaaggtgtatgagaacgtgacgggcctggtcaaggctgttata
gagatgtccagtaagatccagccagcccctccagaagagtacgtccctatggtcaaggag
gtgggactagctttgagaaccctattggccacagtggacgagaccataccagtgttacca
gcaagcacacacagagagattgagatggcccagaagctcttgaactctgacctggccgag
ctgatcaacaagatgaagctggcccagcagtatgtcctcaccagcctgcagcaggactac
aagaaacaaatgctgactgccgcacatgccctggctgtggatgccaagaacctgctggat
gtcattgaccaggcccggctcaagatgatccatgcccagtcccgggggtcacactag

KEGG   Salmo salar (Atlantic salmon): 106588992
Entry
106588992         CDS       T04363                                 

Definition
(RefSeq) focal adhesion kinase 1-like
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106588992
   04370 VEGF signaling pathway
    106588992
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106588992
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106588992
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106588992
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  FAK family
   106588992
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106588992
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 106588992
NCBI-ProteinID: XP_014034067
UniProt: A0A1S3Q299
LinkDB
Position
ssa27
AA seq 1130 aa
MRFCETSGCWQAVGPGREKAEGPAPVESRPGCSPFPMCCAPEYDRHLAHSKGMATAYLDP
NLNHALAGGAKSRLSAGTGTATERAPGAPDRVLKVFHHFESNSEHSTWASNIRHGDATDV
RGIIQKILDIHKVKCVACFGLRLSHSQSGQVHWLHPDMGVSHVREKYEQNRSQEEWRYEL
RIRYLPKGFLHHFSEDKPTLNYFYQQVKNDYMVEIAVQVEQDIALKLGCLEIRRFFREMR
GNALDKKSNYELLEKDVGLRRFFPKSLLDSVKAKTLRKLIQQTFKQFANMNDDQSILMFL
EILAPVYRFDKECFKCALGLSWVIQVELAIGPEEGISYLTDKGSTPTHLANFTQVQTIGY
SVMEDKERKGMLQLNVAGAAEPLTVTTPSLTTAENMADLIDGYCRLVNGATQSFIIRPQK
EGERALPSIPKVPNNEKKVVEGVVRSAGVRAISVSEDCSGDETDDYAEIIDEEETYTMPS
TVSYGVDEARDYEIQRDRIELGRCIGEGQFGDVHQGVYNSPENPTLNVAIKTCKNSTSDS
VREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTMGELRSFLQVRKYNLDLSTL
ILFSHQLSTALAYLESKRFVHRDIAARNVLVSSTDCVMLGDFGLSRYMEDSSYYKASKGK
LPIKWMAPESINFRRFTSASDVWMFGVCMWEILMYGIKPFQGVKNNDVIGRIENGERLAM
PHNCPPTLYSLMTKCWAYDPSKRPRFTELKTQLSTILEEEKAQQEERLRMEMRRQVTVSW
DSGASDEAPPKPSRPGYPSPRSSEGFYPSPQHAGQLNHYQVGYPGPHVIPAMPSGGYSPQ
AGVLDPQEAWNHHRPGDVPMWSPNMEDGGALDMRGLGQVLPPQLMVERLMMQQQQMEEDQ
RWLEQEECFLKPESRNSRGSIDREDCSLQGPTGNVYQPVGLGKPEHVAPPKKPPRPGAPS
HLGSLASLNPVDSYNEGVKIQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQP
APPEEYVPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLAELINKMKLA
QQYVLTSLQQDYKKQMLTAAHALAVDAKNLLDVIDQARLKMIHAQSRGSH
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgcgtttctgtgagacctcggggtgttggcaggccgtggggcccgggagagagaaagca
gagggaccagctcccgtggagtccagacccggctgcagcccctttcccatgtgctgtgct
ccagaatatgacagacacctagcgcacagcaaaggcatggcgacagcatacctggacccc
aacctcaaccacgccctggctgggggggccaagtcgcgcctcagcgcgggcacaggcacg
gccaccgagcgagcccctggggctccagacagggtcctgaaggtcttccatcacttcgag
agcaacagcgagcacagcacatgggccagtaacatccgccatggggacgccaccgatgtc
agggggatcatccagaagattttggacattcacaaggtgaaatgcgttgcgtgctttggc
ctgcgtctcagccactcccagtctggccaggtccactggctccaccctgatatgggtgtg
tcccatgtgagggagaagtacgaacagaaccgttcccaggaggagtggagatatgagctg
cgtattcgctaccttccaaagggattcctgcaccacttcagtgaagacaaacccacactc
aactacttctaccagcaggtgaaaaatgactacatggtggagatagcggttcaggttgag
caagacattgcacttaagttgggatgccttgaaatcaggagattcttccgggagatgcga
ggaaatgccctggacaaaaaatctaactatgaactattagaaaaagacgtgggcttaaga
agattcttccccaagagtttactggattcagtcaaggccaaaaccctgcggaagctgatc
cagcagacattcaaacagtttgccaacatgaatgatgaccagagcatcctcatgttcctg
gagattctggcgcccgtctacagattcgataaggagtgttttaaatgtgctctcgggttg
agctgggtcatccaagtagagttagccatcggacctgaggagggcattagctaccttaca
gacaagggctcaactccaacccacctggccaacttcacccaggtgcagaccattgggtac
tccgtcatggaggacaaagagagaaagggcatgctgcagctcaatgtggccggtgctgct
gagcctctcacagtgaccacgccgtcactcaccacagctgaaaacatggccgacctcata
gacggctactgtcgcctggtcaacggagccacccagtccttcatcatacggccacagaaa
gaaggagagagagcattgccgtcaatccctaaggtacccaacaatgagaagaaggtagta
gagggggtggtccggagcgctggggtgcgtgccatctctgtctcagaggattgtagtggg
gatgagacggacgattatgctgagattatagacgaagaggaaacctacaccatgccttca
acagtgagctatggagtagacgaagccagggactatgagatccagagagaccggatagag
cttggacgctgcatcggagagggacagtttggagacgtccaccagggagtctacaacagc
ccggagaatcccactctgaacgtggccattaaaacatgcaagaactccacatcggacagc
gtgcgtgagaagttccttcaggaagcattgaccatgcgtcagttcgaccacccccacata
gtgaagttgatcggtgtgatcacagagaacccagtgtggatcatcatggagctgtgcacg
atgggagagttgaggtcctttttacaagtaaggaagtacaacctggatctgtcaacgttg
atcctgttctcccaccagctcagcacagccttggcatacctggagagcaaacgctttgtc
catagggacattgctgccaggaacgtgctagtgtcttccacagactgtgtgatgctggga
gactttggactctcgcgttacatggaggacagttcctactacaaagcttccaaaggaaaa
cttccaatcaaatggatggctccagaatccatcaacttcagacgctttacctctgccagc
gatgtgtggatgtttggtgtgtgcatgtgggagatcctcatgtacggtatcaagcccttc
cagggggtgaagaacaatgatgtcatcgggcggatagagaacggagagcgtctggccatg
cctcacaactgcccccccaccctgtacagcctgatgaccaagtgctgggcctacgacccc
agcaagagaccccgcttcacagaactcaaaacccagctcagtactatcctggaggaggag
aaggcccagcaggaggagagactgaggatggagatgagacgtcaggtcactgtgtcctgg
gactcaggggcctctgacgaggccccccctaaacctagcagacctggttaccccagccct
cgctctagtgaaggattctaccccagccctcagcatgctggacagctcaaccattaccag
gttgggtaccctggcccccacgttattcccgctatgcccagtggagggtactctccccag
gccggtgttctggaccctcaggaggcctggaaccaccaccgaccaggagacgtccccatg
tggtccccaaacatggaggacggaggtgcgttggacatgcgtggtctgggccaggtgctg
cccccccaactgatggtggagaggctgatgatgcagcagcagcagatggaggaggaccag
cgctggttggagcaggaggagtgcttcctgaagccagaatccaggaactcacggggcagc
attgaccgggaggactgcagtctccaggggccgacaggaaacgtataccaaccagtggga
ctggggaaaccagagcatgtggcccctcctaagaagcctcctcgtcctggagcccccagc
cacctgggcagtctggccagcctcaaccccgtagacagctacaacgagggggtcaagatc
cagcctcaggagatcagccctccccccacggccaacttggaccgctccaacgacaaggta
tatgagaacgtgacaggcctggtcaaggctgttatagagatgtccagtaagatccagcca
gcccctccagaggagtacgtcccaatggtcaaggaggtgggactagcgttgagaacccta
ttggccacagtggacgagaccataccagtgttaccagcaagcacacacagagagattgag
atggcccagaagctgttgaactctgacctggccgagctgattaacaagatgaagctggcc
cagcagtacgtcctcaccagcctgcagcaggactacaagaaacagatgctgacggcggcc
cacgccctggccgtagacgccaagaacctgctggatgtcatcgaccaggcccggctcaag
atgatccacgcccagtcccgggggtcacactag

DBGET integrated database retrieval system