KEGG   Salmo salar (Atlantic salmon): 106571097
Entry
106571097         CDS       T04363                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04145  Phagosome
sasa04350  TGF-beta signaling pathway
sasa04510  Focal adhesion
sasa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106571097
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106571097
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106571097
  09143 Cell growth and death
   04115 p53 signaling pathway
    106571097
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106571097
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106571097
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106571097
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106571097
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106571097
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   106571097
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   106571097
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 EGF_CA Laminin_G_3 EGF TSP1_CCN cEGF Laminin_G_2
Other DBs
NCBI-GeneID: 106571097
NCBI-ProteinID: XP_013999241
UniProt: A0A1S3M8F6
LinkDB
Position
ssa15
AA seq 1172 aa
MKLTGIFLLLMLWTCESVRVAESRDDNSVYDLFELVQIPKKNHGVTLVKGDDPYSPAYKI
LNPDLIPEVPESSFRDLIYSIHAERGFLLLLNFKQFKRTRGSLLTVEKRDGSGAVFEIVS
NGKANTLDVVFSTVNKQQVVSIEDVDLATGHWKNITLFVQEDRAQLYVGCEEVNTAELDA
PIQSILTQETPITARLRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQNSVLTDGI
IIMDNPINGSSPAIRTDYTGHKSKDLQMICGFSCEDLAGMFKELKGLGVVVKELSNELRK
VTDENKLLMNRAGIHSGVCLHNGIVHKNKAEWTVDDCTECTCQNSATVCRKISCPLIPCA
NATVSDGECCPRCGTLSDYAEDGWSLWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSV
QTRDCYLQECDKRFKQDGAWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQLGGKDCQGEG
RQTEKCTKSPCPINGNWGPWSLWDTCSSTCGGGAQTRKRLCNDPAPKYGGKECQGDSKAT
QLCNKNACPIDGCLSNPCFPGTKCTSFPDGTWSCGKCPTGYSGDGIKCKDIDECKEVPDA
CFVFNGVHRCENTDPGYNCLPCPARYSGPQPFGRGVEEATVKKQVCTPLNPCLDGSHDCN
KNARCNYLGHFADPMYRCECKPGYAGNGHICGEDSDLDGWPNQDLVCVENATYHCKKDNC
PNLPNSGQEDYDKDGVGDACDNDDDNDGIPDDRDNCPFVYNPRQYDYDRDDVGDRCDNCP
YNSNPDQTDTDNNGEGDACSVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPL
EHNPDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDEKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDNVPDIYDVCPENFDISETDFR
KFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWSNKPTKAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGNTPGQVRTLWHDPKNVGWKDFTAYRWHLIHRPRTGHIRVVMYEGKKIMKDSGSI
YDKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagttgacaggaatatttctgctattgatgctttggacctgcgagagcgtacgagtt
gcagagagccgagacgacaatagcgtgtacgacctgttcgagctggtccaaatccccaag
aagaaccacggagtgaccctagtgaagggcgacgacccatacagtcccgcctacaagatc
ctcaacccggacctgatccccgaggtccccgagagctccttcagggacctcatttattcc
atccacgccgagagaggattccttctccttctcaacttcaagcagtttaagcggaccagg
ggctcccttctgacggtggaaaagcgggacgggtccggagccgtgttcgagatagtctcc
aacgggaaagcgaacaccctggatgtggttttctccacagtgaataagcaacaggtggtg
tcgatagaagatgtggacttggcaacgggccactggaagaatattacgctgtttgtgcag
gaggaccgggcgcagctgtatgttggctgtgaggaggtgaacacggcggaactggacgct
cccatccagagcatcctcactcaggagactcccatcacagcgcgtctcagaatcgggaag
ggagcggtgaaggacaggttcatgggggtgctccaaaacgttcgctttgtctttggaacc
actttagaagcaatactgcgcaacaaaggatgccaaaactctgttctgactgatggaatc
atcattatggacaaccccatcaatgggtccagccctgccattaggactgactacactggc
cacaaaagtaaagacctgcagatgatctgtggattctcctgtgaggacctggctggcatg
ttcaaggaactgaaggggttgggagtggtggtgaaggagctgtctaacgagctgcgcaaa
gtgacggatgagaacaagctgttgatgaacagagcggggatccacagtggagtctgtctg
cacaacggcatcgtccacaagaacaaggcagagtggaccgtcgacgactgcactgagtgc
acttgtcagaactctgccaccgtatgccgcaagatctcctgcccgctgatcccctgtgcc
aacgccaccgtgtccgatggagagtgctgcccacgctgtggaacactgagtgactatgcg
gaggacggctggtccctgtggtctgaatggacacactgttccgtgtcgtgtgggcggggc
atccagcagcgaggccgctcctgcgatcgtattaacaacaactgcgagggaacctccgtc
caaaccagggactgctaccttcaggagtgtgacaaacgcttcaagcaggacggtgcctgg
agccactggtccccctggtcttcctgctcggtcacctgtggggcgggtgtcatcacccgt
atccgtctctgcaactcccccacaccccagctgggaggcaaggactgccagggagaggga
agacagactgagaagtgcaccaagtcaccctgccccatcaacggtaactggggaccctgg
tcgctatgggatacctgctcttccacctgtggaggaggagcccagacacgtaaacgtctc
tgcaacgaccccgcccctaaatatggtggtaaggagtgccagggtgactccaaggccact
cagctgtgcaacaagaacgcctgtcccatcgatggctgtctgtctaacccctgctttcct
gggaccaagtgcaccagctttcccgatggaacatggagttgtgggaaatgtcccactggt
tactctggtgacggcatcaagtgcaaggacattgacgagtgtaaagaggttcctgatgct
tgcttcgtgttcaacggagtgcaccgctgtgagaacactgaccctggctacaactgtctg
ccctgtcccgcacgctactctggacctcagccctttggcaggggagtggaggaggccacc
gtcaagaaacaggtgtgtacaccacttaacccttgcttggatgggagccacgactgcaac
aagaacgcacgctgtaactacctgggacactttgctgaccccatgtaccgctgtgagtgt
aagcctggctatgctgggaacggacacatctgtggtgaagactcggacctggacgggtgg
cccaaccaagacctggtctgtgtggagaacgccacctaccactgcaaaaaggacaactgc
cccaaccttcccaactcaggccaagaagactacgacaaggatggtgttggtgacgcttgt
gacaacgatgatgacaatgatggtattcctgacgacagggataactgtccgtttgtgtac
aaccccaggcaatatgactatgacagagatgatgttggagatcgttgtgataactgtcct
tacaacagcaaccctgaccagaccgacacagacaacaacggggaaggagacgcctgctct
gtcgacattgatggagatggtattctgaatgagaaagataactgcccgtacgtctacaac
gtggatcagagagacactgacctggatggtgtgggagacatgtgtgacaactgtcctctg
gaacacaaccctgaccaggttgactctgatgacgaccgtgtgggagacaagtgtgacagc
aaccaggacattgatgaggacggccaccagaataacctggacaactgcccctacatcccc
aacgctaaccaggccgaccatgacaaagacggcaagggagacgcctgcgaccacgatgat
gacaacgacgggatccctgatgagaaagacaactgcagactggccttcaaccctgaccag
ctcgactctgatggtgatggtcgcggagatgtttgcaaagacgactttgaccaagacaac
gtccctgacatctacgacgtgtgtccggagaactttgacatcagcgagacggacttcagg
aagttccagatggttcccctggaccccaagggaacgtcccagatcgaccccaactgggtg
gtaagacatcaaggcaaagagctggtccagaccgtcaactgtgaccctggcattgctgtt
ggttttgatgagttcaactcggtggacttcagtggaaccttcttcatcaatacagagaga
gatgatgactacgccggctttgtgttcggctaccagtccagctctaggttctacgtggtg
atgtggaagcagatcacacagacttactggagcaacaaacccaccaaggctcagggatac
tcaggactgtccatcaaggtggtcaattctactactggacctggagagcacctcaggaac
gctctctggcatacgggcaacaccccaggacaggtgaggactctgtggcacgaccctaag
aacgttggctggaaagacttcacagcctacagatggcacctgatccacagaccaagaaca
ggacacatcagagtggtcatgtacgaggggaagaagatcatgaaggattccgggagcata
tacgacaagacgtatgcaggtggaagactaggtctctttgtcttctcgcaagagatggta
tacttctcagacctcaagtatgaatgcagagatgcataa

KEGG   Salmo salar (Atlantic salmon): 106587655
Entry
106587655         CDS       T04363                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04145  Phagosome
sasa04350  TGF-beta signaling pathway
sasa04510  Focal adhesion
sasa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106587655
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106587655
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106587655
  09143 Cell growth and death
   04115 p53 signaling pathway
    106587655
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106587655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106587655
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106587655
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106587655
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106587655
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   106587655
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   106587655
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS cEGF Laminin_G_3 EGF TSP1_CCN Laminin_G_2
Other DBs
NCBI-GeneID: 106587655
NCBI-ProteinID: XP_014031743
UniProt: A0A1S3PVL7
LinkDB
Position
ssa01
AA seq 1172 aa
MKPTGVFLLLVLWNCEGSRVAEIGDDNGVYDLFELVKVNKRHQGVTLVKGADPYSPAYKV
LNADLIPPVPEISFRDLIDSVQAERGFLLLVNFKQFKKTRGSLLTVEKNDGSGPIFEIIS
NGKAQTLDVVYSTGNKQQVVSIEDADLATGHWKNITLFIQEDRAQLFVGCEEINISEIDV
PIQKVLTHEVADIARLRIGKGAVKDKFMGVLQNVRFVFGTTLEAIMRNKGCQSSGTLTDV
MTLDNPVNGSSPAIRTDYTGHKSKEIQQVCGFSCEDITSMFKELKGLGVVVKQLSNELNR
VNKESTLLMNQMNIHRGVCLHNGIVHKDKDEWTVDGCTECTCQNSATVCRKISCPLMPCA
NATVPDGECCPRCGTPSDYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINSNCEGTSV
QTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGQG
RETEVCQKSPCPIDGVWGPWSLWDTCSVTCGGGFQTRQRLCNNPTPKYGGKECQGDGKTS
QLCGKEDCPIDGCLSNPCFAGAKCTSFDDGSWKCGACPVGYTGDGINCKDIDECKEVRDA
CFTLNGVHRCENTEPGYNCLACPPRYSGQQPFGRGVEQATAKKQVCTPRNPCQDGSHNCN
KNANCIYLGQFSDTMFRCECKPGYAGNGHICGDDTDLDGWPNKDLLCVENATYHCKKDNC
PNLPNSGQEDHDKDELGDACDQDDDNDGIPDDRDNCPMVYNPAQYDVDRDDVGDRCDNCV
HESNPDQVDTDNNGEGDACAIDIDGDGILNERDNCPYVYNVDQRDTDGDGVGDHCDNCPL
ENNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQLDSDGDGRGDVCKDDFDQDNILDIYDVCPENFAISETDFR
RFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNAVDFSGTFFINTDR
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWSHTPTRAQGYSGVSIKVVNSTTGPGEHLRN
ALWHTGDTAGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKSGLIRVVMYEGKRIMADSGNI
YDKTYAGGRLGMYVFSQEMTYFSDLKYECRDS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagccgacaggagtatttctccttttggtgctttggaattgtgagggcagccgggtg
gcagagattggagatgataacggtgtatacgacctattcgagcttgtgaaggtgaacaag
aggcaccaaggagttaccttggtaaaaggcgcagatccctacagcccagcctataaggtc
ttgaacgcagacctgatccccccggttcccgagatctccttcagggacctcattgattca
gtacaagctgaaagaggattccttctcctcgtcaacttcaagcagttcaagaaaaccagg
ggtagtcttttgactgtggagaagaatgacggatcaggaccgatattcgaaattatttct
aatggcaaggcgcaaactctggatgtggtatactccaccgggaacaagcaacaggtagtg
tccatagaagatgcagatctagcgacaggacattggaagaatatcacgctgttcattcag
gaagatcgtgcccagctgttcgtaggatgtgaagagatcaatatatccgaaatagacgtg
cccattcaaaaggtcctgacgcatgaggttgcggacattgcccgtctgagaattggaaaa
ggagctgtgaaagacaaatttatgggagtgcttcagaacgtgcgcttcgtttttggaacc
actttggaggcaatcatgcgcaataagggatgccaaagctctggaacattgactgatgtc
atgaccctggacaacccagtcaatgggtctagcccagcaataaggactgattacactggc
cacaaaagcaaagaaattcagcaggtctgtggcttttcctgtgaggatatcaccagcatg
ttcaaggagctcaagggactcggcgtggttgttaagcagctgtcaaacgagctcaacaga
gtgaataaggagagcactctgctcatgaaccagatgaacatccacagaggggtctgtctt
cacaacggcatcgtgcacaaggacaaagatgagtggaccgtggacggctgcacagagtgt
acctgccagaactctgccactgtgtgtcgcaaaatctcttgccccctgatgccctgtgcc
aacgccaccgtgcccgatggagagtgctgcccacgttgtggaaccccgagtgactacgct
gaggatggttggtccccctggtctgaatggactcattgttctgtgtcttgtggacgggga
atccaacagcgaggtcgatcatgcgaccgcatcaacagcaattgcgagggcacctctgtg
cagacccgcgactgctaccctcaggaatgtgacaagcgcttcaagcaggatggtggttgg
agccactggtctccctggtcctcttgctctgtgacctgtggtgaaggagtcatcacccgc
attcgcctttgcaactccccaactccccagatgggaggcagagactgccaaggacagggc
agagagaccgaggtctgccagaaatcaccttgtccaattgacggagtctggggaccctgg
tctttatgggacacctgctctgtcacctgtggaggtggattccagacgcgccagcgtctt
tgtaacaaccccacccccaaatacggaggaaaggaatgtcagggtgacggcaaaacatcc
caactgtgtggaaaagaagactgtcctattgatggctgtctgtccaacccctgctttgct
ggcgctaagtgtaccagctttgatgatggttcctggaagtgtggcgcatgcccagtgggc
tacaccggagacggcatcaactgcaaggacatcgatgagtgcaaggaggtccgtgacgca
tgcttcacactcaacggagtccaccgctgtgagaacactgagcctggttacaactgcctt
gcctgcccccctcgctactcaggacaacagcccttcgggagaggagtggagcaggccaca
gccaagaaacaggtgtgcacaccccgtaacccctgccaagatggcagccataattgcaac
aagaatgccaactgtatctacctgggtcagttcagcgacactatgttccgctgtgagtgc
aaacctggttacgctggcaatggtcacatctgtggagatgacactgacctggatggatgg
cccaacaaagacctcctgtgtgtggagaacgccacctaccactgcaagaaggacaactgt
ccaaaccttcccaactctggacaggaggatcacgacaaagatgagcttggtgatgcttgc
gatcaagatgatgacaacgatgggatccctgatgatagggacaactgcccaatggtctac
aaccccgctcagtatgatgtggacagagatgacgttggtgatcgatgtgataactgtgtg
catgagagcaaccccgaccaagtcgacacagacaacaacggagagggggatgcctgtgct
attgacattgacggtgatggcattctaaatgagagggacaactgcccatacgtctacaat
gtggaccagagagacactgacggggatggagtgggagaccactgtgacaattgccctctt
gaaaacaacccagaccagattgactctgactcagaccgtgtgggagacaagtgcgacaac
aaccaggacattgatgaggacggtcatcagaacaacttggacaactgtccctatatcccc
aacgccaaccaggccgaccacgacaaagacggcaagggtgacgcctgtgaccacgatgat
gacaacgacggtatccctgacgacaaggacaactgtaggctggcctttaaccctgaccag
ctggactctgatggtgatggtcgtggagatgtttgcaaagatgactttgaccaagacaac
atacttgatatctacgatgtgtgccctgagaactttgccatcagtgagacggacttccgc
aggttccagatggtaccgctagaccccaagggaacctcccagatcgaccccaactgggtg
gtccgtcaccagggcaaagaactggtgcagaccgtcaactgtgaccctggcattgctgtt
gggttcgatgagttcaacgcagtggactttagtggaacgttctttatcaacacagacagg
gacgatgactatgctggatttgtgtttgggtaccagtccagctccaggttctatgtggta
atgtggaagcagatcacacagacctactggtcccacacgccgaccagagctcagggctac
tccggagtgtccatcaaagtggtcaactccaccacaggacctggggagcatctgaggaac
gccctctggcacaccggtgacactgctggacaggtgcgtactctgtggcacgaccccaag
aacatcggctggaaagactacaccgcctacagatggcacctgatccacaggcccaagtct
ggactcatcagagttgtgatgtatgaaggcaagagaatcatggccgattccggaaatatc
tacgacaagacttatgctggtggaagactaggcatgtatgtcttctctcaggagatgaca
tacttctcagacctcaaatacgaatgcagagattcttaa

KEGG   Salmo salar (Atlantic salmon): 106608163
Entry
106608163         CDS       T04363                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04145  Phagosome
sasa04350  TGF-beta signaling pathway
sasa04510  Focal adhesion
sasa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106608163
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106608163
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106608163
  09143 Cell growth and death
   04115 p53 signaling pathway
    106608163
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106608163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106608163
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106608163
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106608163
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106608163
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   106608163
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   106608163
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC TSP1_ADAMTS EGF_3 Laminin_G_3 EGF_CA TSP1_CCN EGF cEGF Laminin_G_2
Other DBs
NCBI-GeneID: 106608163
NCBI-ProteinID: XP_014061410
UniProt: A0A1S3SAS4
LinkDB
Position
ssa06
AA seq 1172 aa
MKLTGIFLLLMLLTCESVRVAENRDDNSVYDLFELVQVSKKNHGVTLVKGDDPYSPAYKI
LNPDLIPELPESSFRDLIDSIHAERGFLLLLNFKQFKRTRGSLLTVEKRDGSGAVFEIVS
NGKANTLDVVFSTVNKQQVVSIEDVDLATGHWKNITLFVQEDRAQLYVGCEEVNTAELDA
PIQSILTQETPATARLRIGKGAVKDRFMGVLQNVRFVFGTTLDAILRNKGCQNSVLTDGI
VLIDDTINGSSPAIRTDYTGHKTKDLQMICGFSCEDLAGMFKELKGLGVVVKELSNELRK
VTDENKLLMNRVGIHSGVCLHNGIVHKNKAEWTVDDCTECTCQNSATVCRKISCPLIPCA
NATVPDGECCPRCGTPSDYAEDGWSLWSEWTHCSVSCGRGIQQRGRSCDRINNNCEGTSV
QTRDCYLQECDKRFKQDGAWSHWSPWSSCSVTCGAGVITRIRLCNSPTPQLEGKDCQGEG
RQTEKCTKSPCPINGNWGPWSLWDTCSATCGGGAQTRKRLCNDPAPKYGGKECQGDPKAT
QLCNKNTCPIDGCLSNPCFPGTKCTSFPDGTWRCGKCPSAYSGDGIKCNDIDECKEVPGA
CFVFNGVHRCENTDPGYNCLPCPSRYSGPQPFGRGVEEATAKKQVCTPRNPCLDGSHDCN
KNARCNYLGHFADPMYRCECKPGYAGNGHICGEDTDLDGWPNQDLVCVENATYHCKKDNC
PNLPNSGQEDYDKDGVGDACDNDDDNDGIADDRDNCPFVYNPRQYDYDRDDIGDRCDNCP
YNSNPDQTDTDNNGEGDACSVDIDGDGILNEKDNCPYVYNVDQRDTDLDGVGDMCDNCPL
EHNPDQVDSDDDRVGDKCDSNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDEKDNCRLAFNPDQIDSDGDGRGDACKDDFDQDNVPDIYDVCPENFDISETDFR
KFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNSVDFSGTFFINTER
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWNNKPTKAQGYSGLSIKVVNSTTGPGEHLRN
ALWHTGNTPGQVKTLWHDPKKIGWKDFTAYRWHLIHRPRTGHIRVVMYEGKKIMADSGSI
YDKTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagttgacaggaatatttctgctgttgatgcttttgacctgcgagagcgtacgagtt
gcagagaaccgagacgacaatagcgtgtacgacctgttcgagctggtccaagtctccaag
aagaaccacggagtgaccctagtgaagggcgacgacccatacagtcccgcctacaagatc
ctcaacccggacctgatccccgagctccccgagagctccttcagggacctcatcgattcc
atccatgccgagaggggcttcctcctcctgcttaacttcaagcagtttaagcggaccagg
ggctccctcttgaccgtggagaagcgggacgggtccggagccgtgttcgagatagtctcg
aatggaaaagcgaacaccctggatgtggttttctccaccgttaataagcaacaggtggtc
tcgatagaagatgtggacttggcgacgggccactggaagaatattacgctgttcgtgcag
gaggaccgggcgcagctgtatgttggctgtgaggaggtgaacacggcggaactggacgct
cccatccagagcatcctcactcaggaaactcccgccacagcgcgcctcaggattgggaag
ggagcggtgaaggaccggttcatgggggtgctccaaaacgtgcgctttgtctttggaaca
actttggacgcgattctgcgcaacaagggatgccaaaactctgttctgactgatgggatc
gtccttatcgacgacaccatcaatgggtccagccctgccattaggacggactacactggc
cacaaaactaaagacctgcagatgatctgtgggttctcctgcgaggacctggctggcatg
ttcaaggaactgaagggtctgggagtggtggtgaaggagctgtccaatgagctgcgcaaa
gtgacggatgagaacaagttgttgatgaacagagtggggatccacagtggagtctgtctg
cacaacggcatcgtccacaagaacaaggccgagtggaccgtcgacgactgtaccgagtgc
acttgtcaaaactctgccaccgtgtgccgtaagatatcctgccccctgatcccttgtgcc
aacgccaccgtgcccgatggagagtgctgcccacgctgtggaacaccgagtgactatgcg
gaggatggatggtccctgtggtctgaatggacccactgttccgtgtcttgtgggcgggga
attcagcagagaggccgctcctgcgaccgcatcaacaacaactgcgagggaacctccgtc
caaaccagggactgctaccttcaggagtgtgacaaacgcttcaagcaggacggtgcctgg
agccactggtccccctggtcttcctgctcggtcacctgtggggcgggtgtcatcacccgt
atccgcctctgcaactcccccacaccccagctagaaggcaaggactgccaaggagaggga
agacagactgagaagtgcaccaagtcaccctgcccaatcaacggtaactggggaccctgg
tcgctatgggatacctgctctgccacctgtgggggaggagctcagacacgtaaacgtctc
tgcaacgaccccgcccctaaatatggtggtaaggagtgccagggtgaccccaaggccact
cagctgtgcaacaagaacacctgtcccatcgatggctgtctgtccaacccttgcttccct
gggaccaagtgcaccagcttccctgatggaacatggaggtgtggaaaatgcccctctgct
tactctggtgacggcatcaagtgcaatgacattgatgagtgcaaagaggttcctggcgct
tgcttcgtattcaatggagtacaccgctgtgagaacactgaccctggctataactgcctg
ccctgtccctcacgatactctggacctcagcccttcggcaggggagtggaggaagccacc
gccaagaaacaggtgtgtacaccacgtaacccctgcctggatgggagccacgactgcaac
aagaacgcccgctgtaactacctgggacactttgccgaccccatgtaccgctgtgagtgt
aagcctggctatgctggaaacggacacatctgtggtgaggacacggacctggacggatgg
cccaaccaagacctggtctgtgtggagaacgccacctaccactgcaaaaaggacaactgc
cccaaccttcccaactcaggccaagaagactacgacaaggatggtgttggtgacgcttgt
gacaacgatgatgataatgatggtattgctgatgacagggataactgtccgttcgtgtac
aaccccaggcaatatgactatgacagagatgatattggagatcgttgtgataactgtccc
tacaacagcaaccctgaccagaccgacacagacaacaacggggaaggagacgcctgctct
gtggacattgatggagatggcattctgaatgagaaagacaactgtccgtacgtctacaac
gtggaccagagagacactgacctggatggtgtgggagacatgtgtgacaactgtccgctg
gaacacaaccctgaccaggttgactctgatgacgaccgtgtgggagataagtgtgacagc
aaccaggacatcgatgaagacggccaccagaacaacctggacaactgcccctacatcccc
aacgctaaccaggccgaccacgacaaagacggaaaaggagatgcctgcgaccacgatgat
gacaatgacgggatcccagatgagaaagataactgcagactggccttcaaccctgaccag
atcgactccgatggtgatggtcgaggagatgcttgcaaagacgactttgaccaagacaat
gtgcctgacatctacgacgtgtgtccggagaactttgacatcagcgagacggacttcagg
aagttccagatggttcctctggaccccaagggaacgtcccagatcgaccccaactgggtg
gtcagacatcagggcaaagagctggtccagaccgtcaactgtgaccctggcattgctgtt
ggttttgatgagttcaactctgtggacttcagtggtaccttcttcatcaacacagagaga
gatgatgactacgccggctttgtgttcggctaccagtctagctccaggttctacgtggtg
atgtggaagcagatcacacagacctactggaacaacaaacccaccaaagctcagggatac
tcaggactgtccatcaaagtggtcaactccactactggacctggtgagcacctcaggaat
gctctctggcacactggtaacaccccaggacaggtgaagactctttggcacgaccctaag
aaaattggctggaaagacttcacagcctacagatggcacctgatccacagaccaagaaca
ggacacatcagagtggtcatgtacgaggggaagaagatcatggctgattctgggagcata
tatgacaagacgtacgcaggcggaagactaggcctctttgtcttctcacaagagatggta
tacttctcagacctcaagtatgaatgcagagatgcataa

KEGG   Salmo salar (Atlantic salmon): 106610834
Entry
106610834         CDS       T04363                                 

Definition
(RefSeq) thrombospondin-1-like
  KO
K16857  thrombospondin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04145  Phagosome
sasa04350  TGF-beta signaling pathway
sasa04510  Focal adhesion
sasa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106610834
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106610834
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    106610834
  09143 Cell growth and death
   04115 p53 signaling pathway
    106610834
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106610834
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106610834
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106610834
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106610834
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    106610834
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   106610834
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   106610834
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS TSP1_CCN Laminin_G_3 cEGF EGF Laminin_G_2
Other DBs
NCBI-GeneID: 106610834
NCBI-ProteinID: XP_014065925
UniProt: A0A1S3SNL3
LinkDB
Position
ssa09
AA seq 1172 aa
MKLTGVFLLLVLWNCEGSRVAESRDDNSVYDLFELVKVNKRHQGVTLVKGADPYSPAYKI
LNADLIPPVPEISFRDLIDSIQAERGFLLLVNFKQFKKTRGSLLTVEKDDGSGPLFEIIS
NGKAQTLDVVYSTGNKQQVVSIEDADLATGHWKNITLFIQEDRAQLFVGCEEINISEMDV
PIQKVLTHEASDIARLRIGKGAVKDRFMGVLQNVRFVFGTTLEAILRNKGCQSSVTLTDV
MTLDNPVNGSSPAIRTDYTGHKTKDIQQVCGFSCEDIISMFKELKGLGVIVKQLSNELNR
VNKESTLLMNQMNIHRGVCLHNGIVHKDKDEWTVDDCTECTCQNSATVCRKISCPLMPCA
NATVPDGECCPRCGNPSNYAEDGWSPWSEWTHCSVSCGRGIQQRGRSCDRINSNCEGTSV
QTRDCYPQECDKRFKQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGQG
RETEVCQESPCPINGGWGPWSLWDTCSVTCGGGLQTRQRLCNNPAPKYKGKECQGDSKTS
QLCGKEDCPINGCLSNPCFAGAKCTSFDDGSWKCGSCPVGYTGDGINCKDIDECKEVPDA
CFTLNGVHRCENTEPGYNCLACPSRYSGPQPFGRGVEQATAKKQVCTPRNPCQDGSHDCN
KNANCIYLGQFSDTMFRCECKPGYAGNGHICGDDTDLDGWPNKDLLCVENATYHCKKDNC
PNLPNSGQEDHDKDGLGDACDHDDDNDGIPDDRDNCPMVYNPAQYDVDTDDVGDRCDNCV
HESNPDQVDTDNNGEGDACAIDIDGDGILNERDNCPYVYNVDQRDTDGDGVGDHCDNCPL
EHNPDQIDSDSDRVGDKCDNNQDIDEDGHQNNLDNCPYIPNANQADHDKDGKGDACDHDD
DNDGIPDDKDNCRLAFNPDQVDSDGDGRGDVCKDDFDQDNILDIYDVCPENFAISETDFR
RFQMVPLDPKGTSQIDPNWVVRHQGKELVQTVNCDPGIAVGFDEFNAVDFSGTFFINTDR
DDDYAGFVFGYQSSSRFYVVMWKQITQTYWSHTPTRAQGYSGVSIKVVNSTTGPGEHLRN
ALWHTGDTAEQVRTLWHDPKNIGWKDYTAYRWHLVHRPKSGLIRVVMYEGKRIMADSGNI
YDKTYAGGRLGMYVFSQEMTYFSDLKYECRDS
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaagctgacaggagtctttctccttttggtgctttggaattgtgagggcagcagggtg
gcagagagtagagatgataacagtgtatacgacctattcgagctggtgaaagtgaacaaa
aggcaccaaggagttaccttggtaaaaggcgcagatccttacagcccagcctataagatc
ctgaacgcagacctgatccccccggttcccgagatctccttcagggacctcattgattca
atacaagctgagaggggattccttctcctggtcaacttcaagcagttcaagaaaaccagg
ggtagtcttttgactgtggagaaggatgacggatcaggaccgttattcgaaataatttct
aatggcaaggcgcaaactctggatgtggtatactccaccgggaacaagcaacaggtagtg
tccatagaagatgcggatctagcgacaggacattggaagaatatcacgctgttcattcag
gaggatcgtgcccagctgttcgtcgggtgtgaagagatcaatatatcagaaatggatgtg
cccatccaaaaggtcctgacgcatgaggcttccgacattgcccgtctgaggatcggaaaa
ggagctgtgaaagatagatttatgggagtgcttcagaacgtgcgctttgtttttggaacc
actttggaggcgattttacgcaataagggatgccaaagctctgtaactttgactgatgtc
atgacactggacaacccagtaaatgggtccagcccagcaataaggactgattacactggc
cacaaaactaaagatattcagcaggtctgtggtttttcctgtgaggatatcattagcatg
ttcaaggagctcaagggacttggtgtgattgttaagcagctgtcaaatgagctcaacaga
gtgaataaggagagcactctgctcatgaaccagatgaacatccacagaggggtctgtctt
cacaacggcattgtgcacaaggacaaagatgagtggactgtggacgactgcacagagtgt
acctgccagaactctgccactgtgtgtcgcaaaatctcttgccccctgatgccctgtgcc
aacgccaccgtgcctgatggagagtgctgcccacgttgtggaaacccgagtaactatgct
gaggatggctggtccccctggtctgaatggacccattgttctgtgtcttgtggacgggga
atccagcagcgaggtcgctcctgcgaccgcatcaacagtaactgcgaaggcacttctgtg
cagacccgcgactgctaccctcaggaatgtgacaagcgctttaagcaggatggtggctgg
agccactggtctccctggtcctcctgctctgtgacctgtggtgagggagtcatcacccgc
atccgcctctgcaactcccccactccccagatgggaggcagagactgtcaaggacagggc
cgagagacagaggtttgccaggaatcaccttgtccaattaacggaggctggggaccctgg
tctctgtgggacacctgctctgtcacctgtggaggtggactccagactcgccagcgtctc
tgtaacaaccccgcccccaagtacaaagggaaggaatgtcagggtgacagcaaaacatcc
caattgtgtggcaaagaggactgccctatcaatggctgtctgtccaacccgtgctttgct
ggcgctaagtgtaccagctttgatgatggttcctggaagtgtggctcatgcccagtgggc
tacaccggagacggcatcaactgcaaggacatcgacgagtgcaaggaggtccctgacgcg
tgcttcacactcaacggagtccaccgctgtgagaacactgagcctggctacaactgcctt
gcttgcccctcccgctactcaggaccacagcccttcgggaggggagtggagcaggccaca
gccaagaaacaggtgtgcacaccccgtaacccctgccaagatggcagccatgattgcaac
aagaatgctaactgtatctacctgggtcagttcagtgacaccatgttccgctgtgagtgc
aaacctggttacgctggcaatggccacatctgtggagatgacaccgacctggatggatgg
cccaacaaagacctcctgtgtgtggagaacgccacctaccactgcaagaaagacaactgt
ccaaaccttcccaactctgggcaggaggaccatgacaaagatgggcttggtgacgcttgc
gatcacgatgatgacaatgatgggatccctgatgatagggacaactgcccaatggtctac
aaccccgctcagtatgatgtggacacagatgacgttggtgatcgctgtgataactgtgtg
catgagagcaaccctgaccaagtcgacacagacaacaacggagagggagatgcctgtgct
attgacattgacggtgatggtattctaaatgagagggataactgcccctatgtctacaat
gtggaccagagagacactgacggggacggagtgggagaccactgcgacaactgccctctt
gagcacaacccagaccagattgactctgactcagatcgtgtgggagacaagtgcgacaac
aaccaggacattgatgaggacggtcatcagaacaacttggacaactgtccctatatcccc
aacgccaaccaggccgaccacgacaaagacggcaagggtgacgcctgcgaccacgatgac
gacaacgacggtatccctgacgacaaggacaactgcaggctggcctttaaccctgaccag
gtggactctgatggtgatggtcgtggagatgtttgcaaagatgactttgaccaagacaac
atacttgatatctacgatgtgtgccctgagaactttgccatcagcgagacagacttccgc
aggttccagatggtaccactggaccccaagggcacctcccagatcgaccccaactgggtg
gtccgccaccagggcaaagagctggtgcagactgtcaactgtgaccctggcatcgctgtt
gggttcgatgagtttaatgcagtggacttcagtggaacgttcttcatcaacacagacagg
gatgatgactacgctggctttgtgtttggctaccagtccagctccaggttctatgtggtg
atgtggaagcagatcacacagacctactggtcccacaccccgaccagagctcagggctac
tccggagtgtccatcaaagtagtcaactccaccacaggacctggggagcatctgaggaac
gccctttggcacaccggtgacactgctgaacaggtgcgtactctgtggcacgaccccaag
aacattggctggaaagactacaccgcctacagatggcacctggtccacaggcccaagtct
ggactcatcagagttgtgatgtatgaaggcaagagaatcatggcggattctggaaatatc
tacgacaagacttatgctggtggaagactaggcatgtatgtcttctctcaggagatgaca
tacttctcagacctcaaatacgaatgcagagattcttaa

DBGET integrated database retrieval system