KEGG   Salmo salar (Atlantic salmon): 106571195Help
Entry
106571195         CDS       T04363                                 

Definition
(RefSeq) ammonium transporter Rh type A-like
  KO
K06580  ammonium transporter Rh
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106571195
   04090 CD molecules [BR:sasa04090]
    106571195
Transporters [BR:sasa02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   106571195
CD molecules [BR:sasa04090]
 Proteins
  106571195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp AzlD
Motif
Other DBs
NCBI-GeneID: 106571195
NCBI-ProteinID: XP_013999449
UniProt: A0A1S3M8W9
LinkDB All DBs
Position
ssa15
AA seq 438 aa AA seqDB search
MPAYSTNMRLKFPILALTLEIITIILFAVFVVYDDGKHGGHGAHNNATHHEEKTEQNPLT
LYPMFQDVHVMIFIGFGFLMTFLKRYGFSSVGLNLLLAAFALQWGLLVQGLWHLDEGKIK
VSIFKMINADFSTATVLISFGAVLGKTSPVQLLIMTLLEITIFGINEHLVAEVLKANDVG
ASMIIHAFGAYFGLAVARMLYRPALRNGHENDGSVYHSDLFAMIGTVFLWMFWPSFNSAI
AEPGADQLMAVTNTYFSLAACVLSAYAVSSLVEHKGKLDMVHIQNATLAGGVAVGTCADM
DIGPFGAMIIGFVAGIVSTLGFKFLTPILASNLGIQDTCGVHNLHGMPGILGGIAGIVAV
ALGKKNGSAAMQAAALASSLGFALVGGAMTGLIMKLPFWGQPPDQNCFDDSIYWEVPEEE
EGEESLAHGDHSMNKAEA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcttactccaccaacatgaggctgaagtttcccatcctggctctgactctggag
attatcaccatcatcctgtttgctgtgtttgtggtctacgatgatgggaaacacgggggg
cacggagcccacaacaatgccacacaccatgaggagaagacggaacagaatcctctgacc
ctctaccccatgttccaggatgtccacgtgatgatcttcattggcttcggcttcctgatg
accttcctgaagagatatggcttcagcagcgtgggcctcaacctgctcctggctgccttc
gctctgcagtggggtctcctcgtgcaaggcctctggcacctggacgaaggaaagatcaaa
gtctccatcttcaagatgatcaacgcagacttcagcacagccacggttctgatctcgttc
ggggcggtcctgggaaaaaccagcccagtccagctcctcatcatgaccctccttgagatc
accatcttcggcatcaatgaacatctggtggccgaagtcctgaaggccaatgatgttggg
gcctccatgattatccatgccttcggggcatacttcggtctagcagtggcccgtatgctg
tacaggccagctctgcggaacggtcatgagaacgacggctctgtctaccactctgacctc
ttcgccatgatcggtactgtgttcctctggatgttctggcccagtttcaactctgccatc
gcagaacccggtgctgatcagctcatggctgtcaccaacacctacttctcgctggctgcc
tgtgtgctctccgcctacgccgtctccagcctggtggagcacaaagggaaactggacatg
gtccacatccagaatgccactctggccggaggtgttgccgtgggaacctgcgctgacatg
gacatcgggcctttcggtgccatgatcatcggattcgtggctggcatcgtctccaccctg
ggcttcaagttcctcactcccatcctggcatccaacctgggcatccaggacacctgtggc
gtccacaatctgcacggcatgcctggcatccttgggggtatcgctggcattgtggctgtc
gctctgggaaagaagaatgggagcgctgccatgcaggctgcagccctggcctcatccctt
gggttcgctttggttggaggagccatgacaggtctgataatgaagcttccattctgggga
cagcctccagatcagaactgctttgatgattcaatctattgggaggttcctgaagaggaa
gagggcgaggagagcctggctcacggagaccattccatgaacaaagcagaggcctaa

DBGET integrated database retrieval system