KEGG   Salmo salar (Atlantic salmon): 106571385
Entry
106571385         CDS       T04363                                 

Gene name
nrg1
Definition
(RefSeq) neuregulin 1
  KO
K05455  neuregulin 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106571385 (nrg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106571385 (nrg1)
   00536 Glycosaminoglycan binding proteins [BR:sasa00536]
    106571385 (nrg1)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106571385 (nrg1)
Glycosaminoglycan binding proteins [BR:sasa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   106571385 (nrg1)
SSDB
Motif
Pfam: Neuregulin Ig_3 I-set Ig_2 ig V-set EGF C2-set_2 Ig_6 EGF_2 Cyt_b-c1_8 DUF973
Other DBs
NCBI-GeneID: 106571385
NCBI-ProteinID: XP_013999888
UniProt: A0A1S3M9M2
LinkDB
Position
ssa01
AA seq 777 aa
MRTYFATGQSSFTILVVCGIFVSFSISPHGGLCGLTCNNPSPVAPLQELVHRSRVVFEGK
LQEDGRKRDINRRERVKLLNQRAGGIRNESAVQTMKGEVDLSSESVPNRTSESEPYQVRI
RVHQVWEVKAGGLEKDSVVSIVWNRGENCLTLTKDTRYMFFMEPTNDTSVFHAVFPPVET
RRAVRKDVSKVLCQECAEPKLKEMKSVEVVEGMKTFLKCELGAGNPSPKFKWYKEGVDLA
SIKNKLKGTKLKRKKEGKVSELHFKKTSDAHAGSYTCEAINNLGKTSTVGNVTLLRAVTS
TTPAVKTSSHVTACSDSEKNYCVNGGECFTLEVTPGSTKFLCRCPNEFTGDRCQNYVMAS
FYKHLGIEFMEAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLR
NERNTIIANGPQISNPPLENVQLANQFVSKNALPAQHVIEKETETSFSTSLYTSSAHQST
TVTHTSSQSWSNGHSESALSDSRSVLVKSSGENSRHATPSHRGRLNGTGGARDLSGYLKN
SGDTPDSYRDSPYSERYVSAMTTPTRLSPVELLSPVTPGSPPSEMSAPLSSLATSVPSVA
VSPSGEEERPLLFTTQPRPDHHISQSKRKSAHYNHGHEAHSPPPSPLRIVEDDDYETTQE
YEVVGSAATVTPIPPQSLPKKLAKNSNGRRADRTKPNGHAAGHNMESIDLGSSTESEMEE
ERVGEDTPFLSLQNPMAIGVEPLADGSRTNLALRLSPQDNLQARLSSVISNQDPIAV
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgaggacatactttgcgacgggacagagttcattcactattttggttgtttgtggaatt
tttgtgtccttttccatctctccgcatggagggctgtgtgggctgacttgtaataacccc
tctcctgtggctccgctgcaggagttggtgcaccggtcgagagttgtgtttgagggaaag
cttcaagaagacgggcgcaagagagatatcaaccgacgagagcgggtaaagctactcaat
caaagagctggtggtatacggaatgagagcgcggtccagacaatgaaaggagaagttgat
ttgtcgtcagaatcggtgccaaacaggacgtcagagtcggaaccataccaggttaggata
agggtccatcaagtatgggaagtaaaagcggggggcctcgagaaggattctgtcgtttct
attgtctggaaccggggtgaaaactgtttgacgttgactaaagacacaagatacatgttc
ttcatggaacccacgaatgacacgtcggtgttccacgccgttttcccacctgtcgagacg
cggcgagctgtccgaaaggatgtcagcaaagtgctctgccaagaatgtgctgagcccaag
ctgaaggagatgaagagtgtggaggtcgtggaggggatgaagacattcttgaagtgcgag
ctcggagcggggaacccatcccccaaattcaagtggtacaaggagggggtcgatttagcc
agcatcaagaacaaactcaaaggcaccaagttaaaaagaaagaaagaagggaaagtctct
gagctccacttcaagaaaacctctgatgcacatgctggctcctacacatgcgaagccatc
aacaacctggggaaaaccagcaccgtcggtaacgtgacgctcctccgcgctgtcaccagc
accacccctgcggtgaagacctctagccatgtgacggcctgcagcgacagcgagaagaac
tactgcgtaaacggaggggagtgtttcaccctggaggtcacccccggcagcaccaagttc
ctctgcaggtgtccaaatgaatttactggtgatcgctgccaaaactacgtaatggccagt
ttctacaaacatcttgggattgaatttatggaagcagaggagctgtatcagaaacgtgta
ttaacaataacaggaatctgcattgcactcctagtggttggaatcatgtgtgtggttgcc
tactgcaaaacaaaaaagcagaggaaaaagcttcatgatcgtctgaggcagagcctacga
aatgagagaaacaccattatagctaacggccctcagatttctaaccctccccttgaaaac
gtccagcttgccaatcaatttgtgtctaaaaatgcattgcctgcgcagcatgtaatcgag
aaggaaacagaaacatccttctcaacgagcctgtacacatcatcagcacatcagtccaca
actgtcacccacacctccagtcaaagctggagtaacggccacagcgagagtgccctctcc
gacagccgctctgtcttggtgaagtcatcgggagagaacagccggcacgccacgcccagc
caccggggtcgtctgaacggcacaggtggcgccagagacctgagtggctacctaaagaac
tctggagacacgccagactcctacagggactctccgtacagtgagaggtatgtgtcagcg
atgaccaccccaacccgcctgtctcctgtggagctgctctctcccgtgaccccgggctcc
cctccctctgagatgtcggcccccttgtccagcctggccacctcggtcccctctgtggcc
gtcagcccctctggcgaggaagagcgccccctgttgttcaccacccagccgcgccccgac
caccacatcagccagtctaagaggaagtctgcccactacaaccacggccatgaggcccac
agccccccgcccagcccgctgaggatcgttgaggacgacgactatgaaaccacgcaggag
tatgaggtggtcggctctgccgccacagtaacgcccattcccccgcagagccttcctaag
aaacttgccaagaacagcaacggccgccgggccgatagaacaaagcccaatggccatgca
gcaggccacaacatggagtccatcgacctaggtagcagtacggagagcgagatggaggag
gagcgcgtgggagaggacacacccttcctgagcttacagaaccccatggctataggtgtg
gaacctctcgcagatggcagcaggactaacctagcactccgactctccccacaggacaac
ctgcaagccaggttatccagcgtcatctccaaccaagatccaattgctgtataa

DBGET integrated database retrieval system