KEGG   Salmo salar (Atlantic salmon): 106572992
Entry
106572992         CDS       T04363                                 

Definition
(RefSeq) NF-kappa-B essential modulator-like
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04210  Apoptosis
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04623  Cytosolic DNA-sensing pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106572992
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106572992
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106572992
   04621 NOD-like receptor signaling pathway
    106572992
   04622 RIG-I-like receptor signaling pathway
    106572992
   04623 Cytosolic DNA-sensing pathway
    106572992
   04625 C-type lectin receptor signaling pathway
    106572992
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    106572992
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106572992
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106572992
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106572992
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   106572992
SSDB
Motif
Pfam: NEMO CC2-LZ zf_C2H2_10
Other DBs
NCBI-GeneID: 106572992
NCBI-ProteinID: XP_014003062
UniProt: A0A1S3MIN7
LinkDB
Position
ssa15
AA seq 575 aa
MVQPQTDTWDMAGDEGGGALRVPAELAANEVVTRLLGDNQQLREALRTSNQALRERCEEM
EEWKRRSREEREFLSCRFQEARALVERLARENHSLTSLASPSNPGANQGLLVNGPSFSQD
SCPESNGGPGSGGEHEKRSETNGTVASSLVSTEPSGGGTGFLQLLKSHKETLEEGMRDLM
RRNEELEKEREEGERERDCLRRSVEQLGSKLVQAQSSGVTEETVQHSDAPPPSDSSHLAK
LTEQLQATQCRYRELQEKLDCLQKTSAQRDRTEVLLKQKDKDCNQLAKDGEALKAQVTSL
LGELRERQSCLDQSQQDRNILDDKLSSTREALAASEREMEQQKKQHSVTVDKLLLQTHNL
EVALKTDRLVITEERRKLAQLQHAYTCLFKDYDCKLKAEGGDMVVRLEEAERALALKQDL
IDKLKEEVEQQRGSLETVPVLTAQAEIYKADFLAEREAREKLNQRKEELQDQLNTALAEM
ERLKQEGTSRARMEEMQQRHLEDFIPRPHIPPQPGVAFNTAPPPSSFRSVGLAAGVAGGV
SGGGAEELPDYRCPKCQYQAPDMDTLQIHVMDCIQ
NT seq 1728 nt   +upstreamnt  +downstreamnt
atggtacagccccagacagacacctgggacatggctggggacgagggaggcggggctctc
cgggttcctgctgagctggcagccaatgaggtggtgaccagactactgggcgacaaccag
cagctccgagaggcgttgcggaccagcaaccaggccctgcgtgagcgctgtgaggagatg
gaggaatggaagcggagatctagagaagagagggaattcctcagctgtcgtttccaggag
gcccgggcgctagtggagagactggccagggagaaccacagccttaccagcctggccagc
ccctccaaccctggagcgaaccaaggcctgctggtcaacggtcccagtttcagccaggac
tcctgccccgaatccaatgggggtcctgggagtggaggggagcatgagaagaggtccgag
accaacggaaccgtagcatcctcactggtcagtacggagccctcaggaggagggactggg
tttctccagctgctgaagagccacaaagagacgttggaagaagggatgagagatctgatg
aggaggaatgaggagctggagaaagagagggaggagggagagcgggagagagactgcctt
cgtcgctcggttgagcagctcggatccaagctggttcaggcgcagagctctggtgttacc
gaggaaacggttcagcattccgatgccccgcccccgtctgacagctcccacctggccaaa
ctcacagagcagctacaagccacacagtgcaggtacagagagctgcaggagaagttagat
tgcctccagaagacttcagctcagagagacagaactgaagtgctgctgaaacagaaggac
aaggactgtaaccagctggctaaggacggcgaggcgctgaaggcccaggtgacgtccctt
ctgggtgagctgagagagagacagagctgtctggaccagagccagcaggaccgcaacata
ctggacgacaagctgagcagtactcgggaagcgttggcagcatcagagagagagatggaa
cagcagaagaagcagcactctgtgaccgtagacaaactactgctgcagacacacaaccta
gaggtcgccctgaagactgaccgcctggttatcactgaagagaggaggaagctagcccag
ctgcagcacgcctacacctgtctgtttaaggactatgactgcaaactaaaggctgaggga
ggagacatggttgttcgtctggaggaagcagagagagcgttggctctgaaacaggacctg
attgacaagctgaaggaagaggtggagcaacagagaggatctctagagaccgtccctgtt
ctcaccgcccaggctgagatctacaaggcggacttcctagcggagcgggaggccagagag
aagttgaaccagaggaaggaggagcttcaggaccagctgaacacggcgctggctgagatg
gagcgtctgaaacaagaggggacgtcacgggctcggatggaggagatgcagcagagacac
ctggaagacttcataccacgaccccacatccccccacaaccaggggttgcctttaacacg
gcccctcccccttcctccttccgcagcgtgggattggctgcaggagtggcagggggtgtc
tctggaggcggggctgaagagctccctgattaccgctgtccaaagtgccagtaccaagcc
cccgacatggacacactgcagatacatgtcatggactgtatccagtaa

DBGET integrated database retrieval system