KEGG   Salmo salar (Atlantic salmon): 106573113
Entry
106573113         CDS       T04363                                 

Gene name
kitlg
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106573113 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106573113 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106573113 (kitlg)
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106573113 (kitlg)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106573113
NCBI-ProteinID: XP_014003298
UniProt: A0A1S3MJ99
LinkDB
Position
ssa16
AA seq 257 aa
MKKSKIWIRICVHLLLCTTFGVHSSEFGDAVTDDITSISLLKQNIPKDYKIPVTYIPKEV
GGMCWVTLNVFHLELSLRGLADKFGNISSNKYNISILIEMLKETRYHMKNLEVITSDFEC
HYRDEKWQTGHYFQFVEDFLKTARSNRDSPEGCDPPPCPTTTKAPATTIATKYPTSGKES
LRFLPEVVERSLLSLLVIPIAAIVFLFVWKVKSRSNQHQSDELKSVEGGLFTGTEESLAP
PLDDISEKNRLNIIETV
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaagaagtcaaaaatttggatacgcatctgtgtccatttattgctgtgcaccacattt
ggagttcactcaagtgaatttggagatgctgtaacagatgacatcacaagcatttcacta
ttgaaacaaaatatacctaaagattacaagattcctgtgacatacattccaaaagaagtg
ggtggaatgtgttgggtcacgctaaatgttttccacttggaactcagtttacgaggatta
gcagacaagtttggaaacatttcgtccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacgcgatatcacatgaagaacttggaggtgatcacgtctgattttgagtgc
cactacagagacgagaaatggcagacaggacactattttcagtttgttgaagattttcta
aaaacggcccgttcgaatagagattcgccagaaggatgcgatccacctccctgtccaaca
acaacaaaggcaccagcaactacaatagcaacaaaataccccacatcagggaaagagtct
ctgaggttcctgccagaagtagtggagagaagcctcctgtcactacttgtaattccaatt
gcagccatcgtgtttctctttgtgtggaaggtgaaatcaaggagcaaccaacatcaatca
gatgaactgaaatcagtggaaggaggcctctttacaggaacagaagagagtttggcacct
ccactagacgacatttctgaaaagaacagattgaacatcattgagacagtgtaa

DBGET integrated database retrieval system