KEGG   Salmo salar (Atlantic salmon): 106573563Help
Entry
106573563         CDS       T04363                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    106573563 (tmprss9)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106573563 (tmprss9)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106573563 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 Ldl_recept_a DUF1986 SEA RVT_1
Motif
Other DBs
NCBI-GeneID: 106573563
NCBI-ProteinID: XP_014004183
UniProt: A0A1S3MLT6
LinkDB All DBs
Position
ssa16
AA seq 830 aa AA seqDB search
MELKKDHEWPPGESAPTPPNSVCCRNITLAFILVLFIGVFVGLLVAYLVEEEHYFMETVE
LKGLKYGPDLQDESSAFSIVLTSTLKTKIKNIFIASSIAHHYIDCNIVTYGNINGNVMAT
YRLVFSVSKVQQYSDNFIQDLLRVGLNALFHGKSIEVPKFGEINTIVLLGASGKSFYNIG
DDMASCPDNTFTCDNGECVTKVNAECDFIPDCADGSDEAYCSCGTRPAMGSRIVGGVDAR
PGELPWQVSLRLHGRHNCGASIINSHWLVTAAHCFEKDNDPKEWTALVGASLVSGEESEA
ISVNIKSVFVSPDYNPMTTDNDVTMLELETPLTFSPYIQPVCLPSSSHVFSPGRNCVVSG
WGALNQHSFDTPPSLQKAVVNIIDSKVCNKSSVYRGSVTDNMMCAGFLQGKVDSCQGDSG
GPLVCEEAPGRFFLAGVVSWGVGCAQINRPGVYSRVTRLRNWILSHTNPGMVHYPAHTPP
MVPVTTPTVSPISKTMVAAPLLHAVNCSENFKCRAGECVSKMNPECDGVIDCSNKADEKN
CDLSAAFDTVDHQILIATLSGLGVLGSAHSWIASYLAGCSNQAGFPDCGMRPAVGSQRIV
GGLTARRGEWPWIGSLQYQRLHRCGATLIHSKWLLTAAHCFKGNSNPVAWSVSLGSVLRS
GVGALVIPIQRTILHPGFNSTNMDYDVALLELAVPAPRSYTIQLVCLPSPVHNFLKNTEC
YITGWGSMREGGSLTNLLQKADVNIIEQSDCQQAYGNSLTPSMMCAGYMEGGKDTCLGDS
GGPLTCREFSGQWFVAGVTSWGHGCGRTAFPGVYMRVTAIREWISNYLHF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggagttaaagaaggatcatgagtggcccccaggggagtccgctcctactccccccaac
tctgtctgctgtaggaacatcaccctggcttttatcctagtcttattcatcggcgtcttt
gtgggcttgttggttgcatacttggtggaagaggagcattacttcatggagacggtagaa
ttgaagggtctcaagtatggccctgacctgcaagatgaaagctctgcattctctatagtg
ctcacttctactctaaagactaagatcaagaatattttcattgcctcgtcaatagcacat
cactatatcgactgtaatattgttacctatggtaacatcaatggcaatgtgatggccaca
tatcgactggtcttcagcgtgtccaaggtccagcagtactctgataactttattcaggac
cttttgagggtaggactgaacgccctgtttcatgggaagtccatagaagtgcctaagttt
ggagagatcaacactattgttttactgggggccagtgggaagtcattctataacattgga
gacgatatggccagctgtcctgacaacacttttacctgtgacaatggggagtgtgtcacc
aaggtcaacgccgagtgtgatttcatcccggactgtgccgacggctctgatgaagcttac
tgctcctgtgggacacgcccggccatgggcagtagaatagtgggtggagtggatgcccgt
cctggggagctgccctggcaggtcagtctgaggctgcatggcagacacaactgtggagcc
tccatcatcaacagccattggcttgtcactgctgctcactgcttcgagaaggacaatgac
ccaaaagaatggacagccctggtaggagccagcctggtgagtggagaagagtcagaagcc
atctctgtgaacatcaagtctgtgtttgtgtccccagactacaaccctatgaccactgac
aacgatgtgaccatgctggagctagagactcccctcaccttcagcccctacattcagcct
gtctgtctgccctcctcctcccatgtcttcagcccaggccggaactgtgtggtgtcaggc
tggggggctctcaaccagcattcctttgatacgccaccatctctacagaaggcagtggtt
aatatcattgattcaaaggtctgcaacaagtcgtccgtttacagaggctctgtgaccgac
aacatgatgtgtgctggcttcctacaagggaaggtcgactcctgtcagggtgactctgga
gggccattggtgtgtgaggaggccccagggcggttcttcctcgctggggtggtgagctgg
ggcgtgggctgtgctcagatcaacaggccaggggtctattcccgtgtcaccaggctacgc
aactggatcctcagccacaccaaccctggcatggtccactaccctgcccacaccccacca
atggtgccagttacaacaccaacagtcagtcctatttccaagacaatggtagcagcccca
ctcctgcatgctgtgaactgtagtgagaacttcaagtgcagggctggggagtgtgtcagc
aaaatgaaccctgagtgtgatggtgtcattgactgctctaacaaggctgatgagaagaac
tgtgatctatccgctgccttcgacaccgtggaccatcagatcctcatcgccaccctctca
gggctaggtgtcttaggctctgcacactcttggattgcatcctacctggcaggctgctcc
aaccaggcagggtttccagactgtggcatgcgtccggcagtgggctcccagaggattgtg
ggtggcttgacggcacggaggggggagtggccatggattggcagcctacagtatcaacgc
ttacaccgctgtggagccactctcatacactctaagtggctcttgactgctgcccactgc
ttcaaaggtaactccaaccctgtcgcctggtcagtgagtctgggttcagtgctgaggtcc
ggggtgggagctctggttatccccatccagaggaccatactgcacccgggcttcaacagc
accaacatggactatgatgtggccctgctggagctggctgtcccagcacccaggtcctac
acaatccagttggtttgcctcccctctcctgtacacaactttctgaagaacactgagtgc
tatatcactggctggggctccatgagggagggaggttctctgaccaacctgctccagaaa
gctgatgtgaacatcattgagcagtcagactgccagcaggcatacggcaacagcctcacc
ccaagcatgatgtgtgccggctacatggaggggggcaaagacacatgcctgggagattct
ggtggccccttgacatgtcgtgaattctctggccagtggtttgttgccggggtaactagc
tggggacatggctgcggacggactgctttcccaggagtctatatgcgggtcactgccatc
agggaatggatatccaactatctgcacttctga

DBGET integrated database retrieval system